Home  |  Contact

UniProtKB/Swiss-Prot Q9UBC3: Variant p.Pro691Leu

DNA (cytosine-5)-methyltransferase 3B
Gene: DNMT3B
Variant information

Variant position:  691
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Proline (P) to Leucine (L) at position 691 (P691L, p.Pro691Leu).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Similar physico-chemical property. Both residues are medium size and hydrophobic.
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Facioscapulohumeral muscular dystrophy 2 (FSHD2) [MIM:158901]: A degenerative muscle disease characterized by slowly progressive weakness of the muscles of the face, upper-arm, and shoulder girdle. The onset of symptoms usually occurs in the first or second decade of life. Affected individuals usually present with impairment of upper extremity elevation. This tends to be followed by facial weakness, primarily involving the orbicularis oris and orbicularis oculi muscles. {ECO:0000269|PubMed:27153398}. Note=The gene represented in this entry may act as a disease modifier. DNMT3B mutations lead to DUX4 expression in somatic tissues, including muscle cells, when an haplotype on chromosome 4 is permissive for DUX4 expression. Ectopic expression of DUX4 in skeletal muscle activates the expression of stem cell and germline genes, and, when overexpressed in somatic cells, DUX4 can ultimately lead to cell death.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In FSHD2.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  691
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  853
The length of the canonical sequence.

Location on the sequence:   LFFEFYHLLNYSRPKEGDDR  P FFWMFENVVAMKVGDKRDIS
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         LFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDIS

Mouse                         LFFEFYHLLNYTRPKEGDNRPFFWMFENVVAMKVNDKKDIS

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 853 DNA (cytosine-5)-methyltransferase 3B
Domain 575 – 853 SAM-dependent MTase C5-type


Literature citations

Mutations in DNMT3B modify epigenetic repression of the D4Z4 repeat and the penetrance of facioscapulohumeral dystrophy.
van den Boogaard M.L.; Lemmers R.J.; Balog J.; Wohlgemuth M.; Auranen M.; Mitsuhashi S.; van der Vliet P.J.; Straasheijm K.R.; van den Akker R.F.; Kriek M.; Laurense-Bik M.E.; Raz V.; van Ostaijen-Ten Dam M.M.; Hansson K.B.; van der Kooi E.L.; Kiuru-Enari S.; Udd B.; van Tol M.J.; Nishino I.; Tawil R.; Tapscott S.J.; van Engelen B.G.; van der Maarel S.M.;
Am. J. Hum. Genet. 98:1020-1029(2016)
Cited for: VARIANTS FSHD2 ARG-527 AND LEU-691; FUNCTION;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.