UniProtKB/Swiss-Prot Q9UNE0: Variant p.Val370Leu

Tumor necrosis factor receptor superfamily member EDAR
Gene: EDAR
Feedback?

Variant information Variant position:

370 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Valine (V) to Leucine (L) at position 370 (V370L, p.Val370Leu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Polymorphism:

Genetic variation in EDAR is associated with variations in head hair thickness and defines the hair morphology locus 1 (HRM1) [MIM:612630]. Besides skin color and facial features, hair morphology is one of the most distinctive traits among human populations, and classical classification of human population is based on such visible traits. Additional information on the polymorphism described.
Other resources:

Links to websites of interest for the variant.

Variant rs1267372612 [ dbSNP | Ensembl ]

Sequence information Variant position:

370 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

448 The length of the canonical sequence.
Location on the sequence:

FDCLEKTSRMLSSTYNSEKA V VKTWRHLAESFGLKRDEIGG The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         FDCLEKTSRMLSSTYNSEKAVVKTWRHLAESFGLKRDEIGG

Mouse                         FDCLEKTSRMLSSTYNSEKAVVKTWRHLAESFGLKRDEIGG

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	27 – 448	Tumor necrosis factor receptor superfamily member EDAR
Topological domain	209 – 448	Cytoplasmic
Domain	358 – 431	Death
Mutagenesis	379 – 379	E -> K. Reduces activation of NF-kappa-B.

Literature citations
Eight mutations of three genes (EDA, EDAR, and WNT10A) identified in seven hypohidrotic ectodermal dysplasia patients.
Zeng B.; Xiao X.; Li S.; Lu H.; Lu J.; Zhu L.; Yu D.; Zhao W.;
Genes (Basel) 7:0-0(2016)
Cited for: VARIANT ECTD10B GLN-420; VARIANT LEU-370;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.