Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P41180: Variant p.Arg66His

Extracellular calcium-sensing receptor
Gene: CASR
Feedback?
Variant information Variant position: help 66 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Arginine (R) to Histidine (H) at position 66 (R66H, p.Arg66His). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to medium size and polar (H) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In HHC1; does not affect homodimerization; impaired N-glycosylation; impaired cell membrane localization; decreased G-protein coupled receptor signaling pathway. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 66 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1078 The length of the canonical sequence.
Location on the sequence: help AKDQDLKSRPESVECIRYNF R GFRWLQAMIFAIEEINSSPA The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         AKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPA

Mouse                         AKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPA

Rat                           AKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPS

Pig                           AKDQNLESRPESVECIRYNFRGFRWLQAMIFAIEEINSSPA

Bovine                        VKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPA
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 20 – 1078 Extracellular calcium-sensing receptor
Topological domain 20 – 612 Extracellular
Region 22 – 188 Ligand-binding 1 (LB1)
Binding site 66 – 70
Binding site 81 – 81
Binding site 84 – 84
Disulfide bond 60 – 101
Mutagenesis 69 – 69 R -> E. Abolishes G-protein coupled receptor signaling pathway.
Helix 65 – 82



Literature citations
Structural mechanism of ligand activation in human calcium-sensing receptor.
Geng Y.; Mosyak L.; Kurinov I.; Zuo H.; Sturchler E.; Cheng T.C.; Subramanyam P.; Brown A.P.; Brennan S.C.; Mun H.C.; Bush M.; Chen Y.; Nguyen T.X.; Cao B.; Chang D.D.; Quick M.; Conigrave A.D.; Colecraft H.M.; McDonald P.; Fan Q.R.;
Elife 5:0-0(2016)
Cited for: X-RAY CRYSTALLOGRAPHY (2.60 ANGSTROMS) OF 20-607 IN COMPLEX WITH CALCIUM; PHOSPHATE AND SULFATE ANIONS AND TRYPTOPHAN; FUNCTION; ACTIVITY REGULATION; DOMAIN; DISULFIDE BONDS; GLYCOSYLATION AT ASN-261; ASN-287; ASN-446; ASN-468; ASN-488; ASN-541 AND ASN-594; MUTAGENESIS OF ARG-69; ASN-102; THR-145; SER-147; SER-170; TYR-218; SER-417 AND TRP-458; CHARACTERIZATION OF VARIANTS NSHPT ILE-100; LEU-227 AND LYS-551; CHARACTERIZATION OF VARIANTS HHC1 HIS-66; MET-81; PRO-159; GLY-172; GLY-215; LYS-297 AND GLU-557; Calcium-sensing receptor dimerizes in the endoplasmic reticulum: biochemical and biophysical characterization of CASR mutants retained intracellularly.
Pidasheva S.; Grant M.; Canaff L.; Ercan O.; Kumar U.; Hendy G.N.;
Hum. Mol. Genet. 15:2200-2209(2006)
Cited for: VARIANTS HHC1 CYS-66; HIS-66 AND 583-ASN--SER-1078 DEL; SUBCELLULAR LOCATION; SUBUNIT; GLYCOSYLATION; CHARACTERIZATION OF VARIANTS CYS-66; HIS-66 AND 583-ASN--SER-1078 DEL; Calcium-sensing receptor mutations and denaturing high performance liquid chromatography.
Cole D.E.; Yun F.H.; Wong B.Y.; Shuen A.Y.; Booth R.A.; Scillitani A.; Pidasheva S.; Zhou X.; Canaff L.; Hendy G.N.;
J. Mol. Endocrinol. 42:331-339(2009)
Cited for: VARIANTS HHC1 SER-42; LEU-55; HIS-66; MET-81; MET-138; ARG-143; ARG-158; GLY-166; TRP-220; ARG-549; TYR-562; GLY-565; TYR-582; 583-ASN--SER-1078 DEL; TYR-661; HIS-680; ILE-761 DEL AND TRP-795; VARIANTS HYPOC1 LYS-118; PHE-125; ARG-129; LYS-228; LYS-604; ILE-802; SER-830; LEU-832 AND SER-832;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.