Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P41180: Variant p.Leu159Pro

Extracellular calcium-sensing receptor
Gene: CASR
Feedback?
Variant information Variant position: help 159 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Leucine (L) to Proline (P) at position 159 (L159P, p.Leu159Pro). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In HHC1; decreased G-protein coupled receptor signaling pathway. Any additional useful information about the variant.


Sequence information Variant position: help 159 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1078 The length of the canonical sequence.
Location on the sequence: help IAVVGATGSGVSTAVANLLG L FYIPQVSYASSSRLLSNKNQ The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         IAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQ

Mouse                         IAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQ

Rat                           IAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQ

Pig                           IAVVGATGSGISTAVANLLGLFYIPQVSYASSSRLLSNKNQ

Bovine                        IAVVGATGSGISTAVANLLGLFYIPQVSYASSSRLLSNKNQ

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 20 – 1078 Extracellular calcium-sensing receptor
Topological domain 20 – 612 Extracellular
Region 22 – 188 Ligand-binding 1 (LB1)
Binding site 145 – 145
Binding site 147 – 147
Binding site 168 – 168
Binding site 170 – 170
Mutagenesis 145 – 145 T -> A. Abolishes G-protein coupled receptor activity.
Mutagenesis 147 – 147 S -> A. Nearly abolished G-protein coupled receptor activity.
Mutagenesis 170 – 170 S -> A. Abolishes G-protein coupled receptor activity.
Helix 147 – 159



Literature citations
Structural mechanism of ligand activation in human calcium-sensing receptor.
Geng Y.; Mosyak L.; Kurinov I.; Zuo H.; Sturchler E.; Cheng T.C.; Subramanyam P.; Brown A.P.; Brennan S.C.; Mun H.C.; Bush M.; Chen Y.; Nguyen T.X.; Cao B.; Chang D.D.; Quick M.; Conigrave A.D.; Colecraft H.M.; McDonald P.; Fan Q.R.;
Elife 5:0-0(2016)
Cited for: X-RAY CRYSTALLOGRAPHY (2.60 ANGSTROMS) OF 20-607 IN COMPLEX WITH CALCIUM; PHOSPHATE AND SULFATE ANIONS AND TRYPTOPHAN; FUNCTION; ACTIVITY REGULATION; DOMAIN; DISULFIDE BONDS; GLYCOSYLATION AT ASN-261; ASN-287; ASN-446; ASN-468; ASN-488; ASN-541 AND ASN-594; MUTAGENESIS OF ARG-69; ASN-102; THR-145; SER-147; SER-170; TYR-218; SER-417 AND TRP-458; CHARACTERIZATION OF VARIANTS NSHPT ILE-100; LEU-227 AND LYS-551; CHARACTERIZATION OF VARIANTS HHC1 HIS-66; MET-81; PRO-159; GLY-172; GLY-215; LYS-297 AND GLU-557; Agonist-driven maturation and plasma membrane insertion of calcium-sensing receptors dynamically control signal amplitude.
Grant M.P.; Stepanchick A.; Cavanaugh A.; Breitwieser G.E.;
Sci. Signal. 4:RA78-RA78(2011)
Cited for: VARIANTS HHC1 PRO-159 AND TRP-795; FUNCTION; SUBCELLULAR LOCATION; CHARACTERIZATION OF VARIANTS HHC1 PRO-159 AND TRP-795;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.