Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P41180: Variant p.Asn802Ile

Extracellular calcium-sensing receptor
Gene: CASR
Feedback?
Variant information Variant position: help 802 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Asparagine (N) to Isoleucine (I) at position 802 (N802I, p.Asn802Ile). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (N) to medium size and hydrophobic (I) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In HYPOC1; increased G protein-coupled receptor signaling pathway. Any additional useful information about the variant.


Sequence information Variant position: help 802 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1078 The length of the canonical sequence.
Location on the sequence: help LLAAICFFFAFKSRKLPENF N EAKFITFSMLIFFIVWISFI The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         LLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFI

Mouse                         LLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFI

Rat                           LLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFI

Pig                           LLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFI

Bovine                        LLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFI

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 20 – 1078 Extracellular calcium-sensing receptor
Topological domain 790 – 805 Cytoplasmic
Region 790 – 805 Intracellular loop 3 (ICL3)
Mutagenesis 801 – 801 F -> A. Abolished G(s)-, G(q)- and G(i)-mediated G-protein-coupled receptor activity.
Mutagenesis 805 – 805 K -> A. Strongly decreased G(q)- and G(i)-mediated G-protein-coupled receptor activity.
Mutagenesis 809 – 809 F -> A. Strongly decreased G(q)- and G(i)-mediated G-protein-coupled receptor activity.
Mutagenesis 812 – 812 L -> A. Abolished calcium-induced G protein-coupled receptor activity.
Mutagenesis 813 – 813 I -> A. Abolished calcium-induced G protein-coupled receptor activity.
Mutagenesis 816 – 816 I -> A. Abolished calcium-induced G protein-coupled receptor activity.
Mutagenesis 822 – 822 I -> W. Increased activation by positive allosteric modulators; when associated with W-781.
Turn 800 – 802



Literature citations
Calcium-sensing receptor mutations and denaturing high performance liquid chromatography.
Cole D.E.; Yun F.H.; Wong B.Y.; Shuen A.Y.; Booth R.A.; Scillitani A.; Pidasheva S.; Zhou X.; Canaff L.; Hendy G.N.;
J. Mol. Endocrinol. 42:331-339(2009)
Cited for: VARIANTS HHC1 SER-42; LEU-55; HIS-66; MET-81; MET-138; ARG-143; ARG-158; GLY-166; TRP-220; ARG-549; TYR-562; GLY-565; TYR-582; 583-ASN--SER-1078 DEL; TYR-661; HIS-680; ILE-761 DEL AND TRP-795; VARIANTS HYPOC1 LYS-118; PHE-125; ARG-129; LYS-228; LYS-604; ILE-802; SER-830; LEU-832 AND SER-832;
Two novel mutations of the calcium-sensing receptor gene affecting the same amino acid position lead to opposite phenotypes and reveal the importance of p.N802 on receptor activity.
Lia-Baldini A.S.; Magdelaine C.; Nizou A.; Airault C.; Salles J.P.; Moulin P.; Delemer B.; Aitouares M.; Funalot B.; Sturtz F.; Lienhardt-Roussie A.;
Eur. J. Endocrinol. 168:K27-K34(2013)
Cited for: VARIANT HHC1 SER-802; VARIANT HYPOC1 ILE-802;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.