Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P14867: Variant p.Leu146Met

Gamma-aminobutyric acid receptor subunit alpha-1
Gene: GABRA1
Feedback?
Variant information Variant position: help 146 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Leucine (L) to Methionine (M) at position 146 (L146M, p.Leu146Met). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In DEE19. Any additional useful information about the variant.


Sequence information Variant position: help 146 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 456 The length of the canonical sequence.
Location on the sequence: help TFFHNGKKSVAHNMTMPNKL L RITEDGTLLYTMRLTVRAEC The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         TFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAEC

Mouse                         TFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAEC

Rat                           TFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAEC

Bovine                        TFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAEC

Chicken                       TFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAEC

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 28 – 456 Gamma-aminobutyric acid receptor subunit alpha-1
Topological domain 28 – 253 Extracellular
Binding site 157 – 157
Glycosylation 138 – 138 N-linked (GlcNAc...) asparagine
Beta strand 143 – 149



Literature citations
Diagnostic targeted resequencing in 349 patients with drug-resistant pediatric epilepsies identifies causative mutations in 30 different genes.
Parrini E.; Marini C.; Mei D.; Galuppi A.; Cellini E.; Pucatti D.; Chiti L.; Rutigliano D.; Bianchini C.; Virdo S.; De Vita D.; Bigoni S.; Barba C.; Mari F.; Montomoli M.; Pisano T.; Rosati A.; Guerrini R.;
Hum. Mutat. 38:216-225(2017)
Cited for: VARIANT DEE19 MET-146;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.