UniProtKB/Swiss-Prot P54278: Variant p.Gly207Glu

Mismatch repair endonuclease PMS2
Gene: PMS2
Feedback?

Variant information Variant position:

207 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

US The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Glycine (G) to Glutamate (E) at position 207 (G207E, p.Gly207Glu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from glycine (G) to medium size and acidic (E) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description:

In LYNCH4; uncertain significance; normal DNA mismatch repair activity; no effect on protein stability compared to wild-type; no effect on ATPase activity; does not appear to induce a significant structural rearrangement. Any additional useful information about the variant.
Other resources:

Links to websites of interest for the variant.

Variant rs374704824 [ dbSNP | Ensembl ]

Sequence information Variant position:

207 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

862 The length of the canonical sequence.
Location on the sequence:

VLHAYCIISAGIRVSCTNQL G QGKRQPVVCTGGSPSIKENI The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         VLHAYCIISAGIRVSCTNQLGQGKRQPVVCTGGSPSIKENI

Mouse                         VLQAYCIISAGVRVSCTNQLGQGKRQPVVCTSGSSGMKENI

Chicken                       ILQAYCIISKGVRINCTNQVGQGKKSPVVSTTGGPNLKENI

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 862	Mismatch repair endonuclease PMS2
Alternative sequence	184 – 862	Missing. In isoform 4.

Literature citations
Biochemical and structural characterization of two variants of uncertain significance in the PMS2 gene.
D'Arcy B.M.; Blount J.; Prakash A.;
Hum. Mutat. 40:458-471(2019)
Cited for: X-RAY CRYSTALLOGRAPHY (2.60 ANGSTROMS) OF 1-365; SUBCELLULAR LOCATION; CATALYTIC ACTIVITY; CHARACTERIZATION OF VARIANTS LYNCH4 42-LEU--GLU-44 DEL AND GLU-207; Four novel germline mutations in the MLH1 and PMS2 mismatch repair genes in patients with hereditary nonpolyposis colorectal cancer.
Montazer Haghighi M.; Radpour R.; Aghajani K.; Zali N.; Molaei M.; Zali M.R.;
Int. J. Colorectal Dis. 24:885-893(2009)
Cited for: VARIANT LYNCH4 GLU-207; Inactivation of DNA mismatch repair by variants of uncertain significance in the PMS2 gene.
Drost M.; Koppejan H.; de Wind N.;
Hum. Mutat. 34:1477-1480(2013)
Cited for: CHARACTERIZATION OF VARIANTS VAL-18; GLN-20; ALA-41; GLU-60; THR-423; LYS-485; ALA-511; MET-511; GLU-541; LEU-563; ILE-571; SER-597 AND ALA-857; CHARACTERIZATION OF VARIANTS LYNCH4 ASN-46; ILE-46; PRO-205; GLU-207; VAL-263; GLN-479; ILE-622; ALA-663; LYS-705; ASP-750; ARG-797 AND TYR-843; MUTAGENESIS OF GLU-41 AND TYR-519;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.