Home  |  Contact

UniProtKB/Swiss-Prot P78357: Variant p.Arg764Cys

Contactin-associated protein 1
Gene: CNTNAP1
Variant information

Variant position:  764
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Arginine (R) to Cysteine (C) at position 764 (R764C, p.Arg764Cys).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (R) to medium size and polar (C)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Neuropathy, congenital hypomyelinating, 3 (CHN3) [MIM:618186]: A form of congenital hypomyelinating neuropathy, a neurologic disorder characterized by early-onset hypotonia, areflexia, distal muscle weakness, and very slow nerve conduction velocities (NCV) resulting from improper myelination of axons. In its extreme form, it may present with severe joint contractures or arthrogryposis multiplex congenita and respiratory insufficiency. In less severe cases patients may achieve walking. Patients lack both active myelin breakdown and well-organized onion bulbs on sural nerve biopsies, have absence of inflammation, and show hypomyelination of most or all fibers. CHN3 is a severe autosomal recessive form characterized by onset of neurogenic muscle impairment in utero. Affected individuals have profoundly impaired psychomotor development and may die in infancy or early childhood. {ECO:0000269|PubMed:27668699, ECO:0000269|PubMed:27818385, ECO:0000269|PubMed:28374019, ECO:0000269|PubMed:29511323}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In CHN3.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  764
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1384
The length of the canonical sequence.

Location on the sequence:   GLLTFVDHLPVTQVVIGDTN  R STSEAQFFLRPLRCYGDRNS
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         GLLTFVDHLPVTQVVIGDTNRSTSEAQFFLRPLRCYGDRNS

Mouse                         GLLTFVDHLPVTQVVVGDTNRSNSEAQFFLRPLRCYGDRNS

Rat                           GLLTFVDHLPVTQVVIGDTNRSSSEAQFFLRPLRCYGDRNS

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 20 – 1384 Contactin-associated protein 1
Topological domain 20 – 1283 Extracellular
Domain 576 – 795 Fibrinogen C-terminal
Glycosylation 763 – 763 N-linked (GlcNAc...) asparagine


Literature citations

Contactin-Associated Protein 1 (CNTNAP1) Mutations Induce Characteristic Lesions of the Paranodal Region.
Vallat J.M.; Nizon M.; Magee A.; Isidor B.; Magy L.; Pereon Y.; Richard L.; Ouvrier R.; Cogne B.; Devaux J.; Zuchner S.; Mathis S.;
J. Neuropathol. Exp. Neurol. 75:1155-1159(2016)
Cited for: INVOLVEMENT IN CHN3; VARIANTS CHN3 623-TRP--GLU-1384 DEL; 671-GLN--GLU-1384 DEL AND CYS-764; FUNCTION;

CNTNAP1 mutations cause CNS hypomyelination and neuropathy with or without arthrogryposis.
Hengel H.; Magee A.; Mahanjah M.; Vallat J.M.; Ouvrier R.; Abu-Rashid M.; Mahamid J.; Schuele R.; Schulze M.; Kraegeloh-Mann I.; Bauer P.; Zuechner S.; Sharkia R.; Schoels L.;
Neurol. Genet. 3:E144-E144(2017)
Cited for: VARIANT LCCS7 672-TRP--GLU-1384 DEL; VARIANTS CHN3 671-GLN--GLU-1384 DEL AND CYS-764; FUNCTION;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.