Home  |  Contact

UniProtKB/Swiss-Prot Q86YT5: Variant p.Leu488Pro

Solute carrier family 13 member 5
Gene: SLC13A5
Chromosomal location: 17p13.2
Variant information

Variant position:  488
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Leucine (L) to Proline (P) at position 488 (L488P, p.Leu488Pro).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Similar physico-chemical property. Both residues are medium size and hydrophobic.
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Epileptic encephalopathy, early infantile, 25 (EIEE25) [MIM:615905]: A disease characterized by seizures appearing in the first days of life, subclinical epileptic status, and recognizable EEG patterns with bilateral, multifocal status epilepticus. Patients have profound or severe delayed development with lack of speech, and most patients do not acquire the ability to sit. Additional variable features include axial hypotonia, peripheral hypertonia, and abnormal involuntary movements such as dystonia and choreoathetosis. {ECO:0000269|PubMed:24995870, ECO:0000269|PubMed:26384929}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In EIEE25.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  488
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  568
The length of the canonical sequence.

Location on the sequence:   TTTLFLPIFASMSRSIGLNP  L YIMLPCTLSASFAFMLPVAT
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         TTTLFLPIFASMSRSIGLNPLYIMLPCTLSASFAFMLPVAT

Mouse                         TTTLFLPIFASMARSIGIHPLYVMIPCTMSASLAFMLPVAT

Rat                           TTTLFLPIFASMARSIGIHPLYVMIPCTLSASLAFMLPVAT

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 568 Solute carrier family 13 member 5
Transmembrane 487 – 507 Helical
Alternative sequence 479 – 524 Missing. In isoform 2.


Literature citations

Mutations in SLC13A5 cause autosomal-recessive epileptic encephalopathy with seizure onset in the first days of life.
Thevenon J.; Milh M.; Feillet F.; St-Onge J.; Duffourd Y.; Juge C.; Roubertie A.; Heron D.; Mignot C.; Raffo E.; Isidor B.; Wahlen S.; Sanlaville D.; Villeneuve N.; Darmency-Stamboul V.; Toutain A.; Lefebvre M.; Chouchane M.; Huet F.; Lafon A.; de Saint Martin A.; Lesca G.; El Chehadeh S.; Thauvin-Robinet C.; Masurel-Paulet A.; Odent S.; Villard L.; Philippe C.; Faivre L.; Riviere J.B.;
Am. J. Hum. Genet. 95:113-120(2014)
Cited for: INVOLVEMENT IN EIEE25; VARIANTS EIEE25 ARG-219; MET-227 AND PRO-488;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.