Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9BZS1: Variant p.Pro339Ala

Forkhead box protein P3
Gene: FOXP3
Feedback?
Variant information Variant position: help 339 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Proline (P) to Alanine (A) at position 339 (P339A, p.Pro339Ala). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (P) to small size and hydrophobic (A) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In IPEX; no loss of protein expression. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 339 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 431 The length of the canonical sequence.
Location on the sequence: help STFPEFLHNMDYFKFHNMRP P FTYATLIRWAILEAPEKQRT The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         STFPEFLHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQRT

Mouse                         SSFPEFFHNMDYFKYHNMRPPFTYATLIRWAILEAPERQRT

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 431 Forkhead box protein P3
Chain 1 – 417 Forkhead box protein P3, C-terminally processed
Chain 52 – 417 Forkhead box protein P3 41 kDa form
DNA binding 337 – 423 Fork-head
Mutagenesis 348 – 348 W -> Q. No loss of DNA-binding. Disrupts dimerization but does not affect DNA-binding; when associated with T-370. Disrupts dimerization, does not affect DNA-binding, causes dysregulated expression of a subset of FOXP3 target genes and impairs its ability to confer inhibitory function to regulatory T-cells; when associated with T-370 and P-372.
Helix 338 – 340



Literature citations
Clinical and molecular profile of a new series of patients with immune dysregulation, polyendocrinopathy, enteropathy, X-linked syndrome: inconsistent correlation between forkhead box protein 3 expression and disease severity.
Gambineri E.; Perroni L.; Passerini L.; Bianchi L.; Doglioni C.; Meschi F.; Bonfanti R.; Sznajer Y.; Tommasini A.; Lawitschka A.; Junker A.; Dunstheimer D.; Heidemann P.H.; Cazzola G.; Cipolli M.; Friedrich W.; Janic D.; Azzi N.; Richmond E.; Vignola S.; Barabino A.; Chiumello G.; Azzari C.; Roncarolo M.G.; Bacchetta R.;
J. Allergy Clin. Immunol. 122:1105-1112(2008)
Cited for: VARIANTS IPEX PRO-242; LEU-324; ALA-339; HIS-347; ALA-373; CYS-374 AND THR-384; CHARACTERIZATION OF VARIANTS IPEX PRO-242; LEU-324; ALA-339; HIS-347; ALA-373; CYS-374 AND THR-384;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.