Home  |  Contact

UniProtKB/Swiss-Prot Q86TP1: Variant p.Asp30Asn

Exopolyphosphatase PRUNE1
Gene: PRUNE1
Variant information

Variant position:  30
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Aspartate (D) to Asparagine (N) at position 30 (D30N, p.Asp30Asn).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and acidic (D) to medium size and polar (N)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Neurodevelopmental disorder with microcephaly, hypotonia, and variable brain anomalies (NMIHBA) [MIM:617481]: An autosomal recessive neurodevelopmental and degenerative disorder characterized by primary microcephaly, profound global developmental delay, and severe intellectual disability. Additional clinical features include dysmorphic features, truncal hypotonia, peripheral spasticity, and lack of independent ambulation or speech acquisition. Brain imaging shows cortical atrophy, thin corpus callosum, cerebellar hypoplasia, and delayed myelination. {ECO:0000269|PubMed:26539891, ECO:0000269|PubMed:28211990, ECO:0000269|PubMed:28334956}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In NMIHBA; loss of function in regulation of cell proliferation and migration; loss of function in neurogenesis; impaired regulation of microtubule polymerization; increased phosphatase activity; no effect on interaction with tubulin beta.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  30
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  453
The length of the canonical sequence.

Location on the sequence:   AALQESRPLHVVLGNEACDL  D STVSALALAFYLAKTTEAEE
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         AALQESRPLHVVLGNEACDLDSTVSALALAFYLAKTTEAEE

Mouse                         AALQDSRPLHVVLGNEACDLDSMVSALALAFYLTKTSEAED

Rat                           AALQESRPLHVVLGNEACDLDSMVSALALAFYLTKTSEAED

Bovine                        AALQESRPIHVVLGNEACDLDSMVSALALAFYLAKTTEAEE

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 453 Exopolyphosphatase PRUNE1
Metal binding 28 – 28 Manganese 1
Metal binding 30 – 30 Manganese 2
Alternative sequence 1 – 232 Missing. In isoform 6 and isoform 7.
Alternative sequence 1 – 182 Missing. In isoform 3 and isoform 5.
Alternative sequence 15 – 174 Missing. In isoform 4.
Mutagenesis 28 – 28 D -> A. Partial loss of cAMP PDE activity. Partial loss of cAMP PDE activity; when associated with D-106. Partial loss of cAMP PDE activity; when associated with D-106 and D-179.


Literature citations

PRUNE is crucial for normal brain development and mutated in microcephaly with neurodevelopmental impairment.
Zollo M.; Ahmed M.; Ferrucci V.; Salpietro V.; Asadzadeh F.; Carotenuto M.; Maroofian R.; Al-Amri A.; Singh R.; Scognamiglio I.; Mojarrad M.; Musella L.; Duilio A.; Di Somma A.; Karaca E.; Rajab A.; Al-Khayat A.; Mohan Mohapatra T.; Eslahi A.; Ashrafzadeh F.; Rawlins L.E.; Prasad R.; Gupta R.; Kumari P.; Srivastava M.; Cozzolino F.; Kumar Rai S.; Monti M.; Harlalka G.V.; Simpson M.A.; Rich P.; Al-Salmi F.; Patton M.A.; Chioza B.A.; Efthymiou S.; Granata F.; Di Rosa G.; Wiethoff S.; Borgione E.; Scuderi C.; Mankad K.; Hanna M.G.; Pucci P.; Houlden H.; Lupski J.R.; Crosby A.H.; Baple E.L.;
Brain 140:940-952(2017)
Cited for: FUNCTION; INTERACTION WITH TUBULIN; INVOLVEMENT IN NMIHBA; VARIANTS NMIHBA ASN-30; THR-54; ASN-106 AND TRP-297; CHARACTERIZATION OF VARIANTS NMIHBA ASN-30 AND TRP-297;

Genes that affect brain structure and function identified by rare variant analyses of mendelian neurologic disease.
Karaca E.; Harel T.; Pehlivan D.; Jhangiani S.N.; Gambin T.; Coban Akdemir Z.; Gonzaga-Jauregui C.; Erdin S.; Bayram Y.; Campbell I.M.; Hunter J.V.; Atik M.M.; Van Esch H.; Yuan B.; Wiszniewski W.; Isikay S.; Yesil G.; Yuregir O.O.; Tug Bozdogan S.; Aslan H.; Aydin H.; Tos T.; Aksoy A.; De Vivo D.C.; Jain P.; Geckinli B.B.; Sezer O.; Gul D.; Durmaz B.; Cogulu O.; Ozkinay F.; Topcu V.; Candan S.; Cebi A.H.; Ikbal M.; Yilmaz Gulec E.; Gezdirici A.; Koparir E.; Ekici F.; Coskun S.; Cicek S.; Karaer K.; Koparir A.; Duz M.B.; Kirat E.; Fenercioglu E.; Ulucan H.; Seven M.; Guran T.; Elcioglu N.; Yildirim M.S.; Aktas D.; Alikasifoglu M.; Ture M.; Yakut T.; Overton J.D.; Yuksel A.; Ozen M.; Muzny D.M.; Adams D.R.; Boerwinkle E.; Chung W.K.; Gibbs R.A.; Lupski J.R.;
Neuron 88:499-513(2015)
Cited for: VARIANTS NMIHBA ASN-30; ASN-106; GLN-128 AND 174-GLY--LYS-453 DEL;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.