UniProtKB/Swiss-Prot Q9BYW2: Variant p.Asp1493Asn

Histone-lysine N-methyltransferase SETD2
Gene: SETD2
Chromosomal location: 3p21.31
Variant information

Variant position:  1493
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Unclassified
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Aspartate (D) to Asparagine (N) at position 1493 (D1493N, p.Asp1493Asn).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and acidic (D) to medium size and polar (N)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Leukemia, acute lymphoblastic (ALL) [MIM:613065]: A subtype of acute leukemia, a cancer of the white blood cells. ALL is a malignant disease of bone marrow and the most common malignancy diagnosed in children. The malignant cells are lymphoid precursor cells (lymphoblasts) that are arrested in an early stage of development. The lymphoblasts replace the normal marrow elements, resulting in a marked decrease in the production of normal blood cells. Consequently, anemia, thrombocytopenia, and neutropenia occur to varying degrees. The lymphoblasts also proliferate in organs other than the marrow, particularly the liver, spleen, and lymphnodes. {ECO:0000269|PubMed:24509477, ECO:0000269|PubMed:24662245}. Note=The disease may be caused by mutations affecting distinct genetic loci, including the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In ALL; unknown pathological significance; somatic mutation.
Any additional useful information about the variant.



Sequence information

Variant position:  1493
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  2564
The length of the canonical sequence.

Location on the sequence:   FDLIEENVYLTERKKNKSHR  D IKRMQCECTPLSKDERAQGE
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         FDLIEENVYLTERKKNKSHRDIKRMQCECTPLSKDERAQGE

Mouse                         FDLIEENVYLTERKKNKSHRDIKRMQCECTPLSKDERAQGE

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 2564 Histone-lysine N-methyltransferase SETD2
Region 1418 – 1714 Interaction with TUBA1A
Metal binding 1499 – 1499 Zinc 1
Metal binding 1501 – 1501 Zinc 1


Literature citations

Identification of functional cooperative mutations of SETD2 in human acute leukemia.
Zhu X.; He F.; Zeng H.; Ling S.; Chen A.; Wang Y.; Yan X.; Wei W.; Pang Y.; Cheng H.; Hua C.; Zhang Y.; Yang X.; Lu X.; Cao L.; Hao L.; Dong L.; Zou W.; Wu J.; Li X.; Zheng S.; Yan J.; Zhou J.; Zhang L.; Mi S.; Wang X.; Zhang L.; Zou Y.; Chen Y.; Geng Z.; Wang J.; Zhou J.; Liu X.; Wang J.; Yuan W.; Huang G.; Cheng T.; Wang Q.F.;
Nat. Genet. 46:287-293(2014)
Cited for: INVOLVEMENT IN AML; INVOLVEMENT IN ALL; VARIANTS AML 70-ARG--GLU-2564 DEL; ASN-800; GLY-1397; SER-1804; TRP-2122; 2325-GLN--GLU-2564 DEL AND LEU-2505; VARIANTS ALL SER-226; ILE-761; ASN-1493; 1496-ARG--GLU-2564 DEL; GLN-1654; 2077-ARG--GLU-2564 DEL; ALA-2214 AND 2524-CYS--GLU-2564 DEL;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.