Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P41220: Variant p.Arg44His

Regulator of G protein signaling 2
Gene: RGS2
Feedback?
Variant information Variant position: help 44 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help US The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Arginine (R) to Histidine (H) at position 44 (R44H, p.Arg44His). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to medium size and polar (H) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help Found in hypertensive patients; uncertain significance; decreased down-regulation of angiotensin-activated signaling pathway; reduced localization at the cell membrane. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 44 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 211 The length of the canonical sequence.
Location on the sequence: help HKSEEKREKMKRTLLKDWKT R LSYFLQNSSTPGKPKTGKKS The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         HKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKTGKKS

Mouse                         PKVEEKREKMKRTLLKDWKTRLSYFLQNSSAPGKPKTGKKS

Rat                           PKVEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKTGKKS

Pig                           PKSEEKREKMKRTLLKDWKTRLSYFLQNSSSPGKPKTGKKS

Bovine                        PKNEEKREKMKRTLLKDWKSRLSYFLQNSSSPGKPKTGKKS

Caenorhabditis elegans        VSVEKKN-------------------QENDGP---------

Baker's yeast                 GDAESSN-----TVLIQLR----------------------

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 211 Regulator of G protein signaling 2
Region 32 – 66 Necessary for membrane association
Mutagenesis 33 – 33 M -> L. Loss of isoform 4 expression.
Mutagenesis 37 – 37 L -> D. Impairs association with plasma membrane.
Mutagenesis 38 – 38 L -> D. Impairs association with plasma membrane.
Mutagenesis 41 – 41 W -> D. Impairs association with plasma membrane.
Mutagenesis 45 – 45 L -> D. Impairs association with plasma membrane.
Mutagenesis 48 – 48 F -> D. Impairs association with plasma membrane.
Mutagenesis 49 – 49 L -> D. Impairs association with plasma membrane.



Literature citations
Human missense mutations in regulator of G protein signaling 2 affect the protein function through multiple mechanisms.
Phan H.T.N.; Sjoegren B.; Neubig R.R.;
Mol. Pharmacol. 92:451-458(2017)
Cited for: FUNCTION; SUBCELLULAR LOCATION; INTERACTION WITH GNAQ; CHARACTERIZATION OF VARIANTS ARG-2; LEU-2; GLY-3; VAL-4; VAL-5; ASN-18; ASP-23; TYR-40; HIS-44; LYS-50; LEU-55; HIS-78; GLY-99; VAL-110; HIS-188 AND ARG-196;
Genetic variations of regulator of G-protein signaling 2 in hypertensive patients and in the general population.
Yang J.; Kamide K.; Kokubo Y.; Takiuchi S.; Tanaka C.; Banno M.; Miwa Y.; Yoshii M.; Horio T.; Okayama A.; Tomoike H.; Kawano Y.; Miyata T.;
J. Hypertens. 23:1497-1505(2005)
Cited for: VARIANTS ARG-2; LEU-2; VAL-5; HIS-44 AND HIS-78;
Analysis of protein-coding genetic variation in 60,706 humans.
Lek M.; Karczewski K.J.; Minikel E.V.; Samocha K.E.; Banks E.; Fennell T.; O'Donnell-Luria A.H.; Ware J.S.; Hill A.J.; Cummings B.B.; Tukiainen T.; Birnbaum D.P.; Kosmicki J.A.; Duncan L.E.; Estrada K.; Zhao F.; Zou J.; Pierce-Hoffman E.; Berghout J.; Cooper D.N.; Deflaux N.; DePristo M.; Do R.; Flannick J.; Fromer M.; Gauthier L.; Goldstein J.; Gupta N.; Howrigan D.; Kiezun A.; Kurki M.I.; Moonshine A.L.; Natarajan P.; Orozco L.; Peloso G.M.; Poplin R.; Rivas M.A.; Ruano-Rubio V.; Rose S.A.; Ruderfer D.M.; Shakir K.; Stenson P.D.; Stevens C.; Thomas B.P.; Tiao G.; Tusie-Luna M.T.; Weisburd B.; Won H.H.; Yu D.; Altshuler D.M.; Ardissino D.; Boehnke M.; Danesh J.; Donnelly S.; Elosua R.; Florez J.C.; Gabriel S.B.; Getz G.; Glatt S.J.; Hultman C.M.; Kathiresan S.; Laakso M.; McCarroll S.; McCarthy M.I.; McGovern D.; McPherson R.; Neale B.M.; Palotie A.; Purcell S.M.; Saleheen D.; Scharf J.M.; Sklar P.; Sullivan P.F.; Tuomilehto J.; Tsuang M.T.; Watkins H.C.; Wilson J.G.; Daly M.J.; MacArthur D.G.;
Nature 536:285-291(2016)
Cited for: VARIANTS ARG-2; LEU-2; GLY-3; VAL-4; VAL-5; ASN-18; ASP-23; TYR-40; HIS-44; LYS-50; LEU-55; GLY-99; VAL-110; HIS-188 AND ARG-196;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.