Home  |  Contact
Due to work on this service, it may not be fully operational on Wednesday March 20 between 1.30 pm and 2.30 pm CEST. Apologies for the inconvenience.

UniProtKB/Swiss-Prot Q9Y263: Variant p.Leu752Phe

Phospholipase A-2-activating protein
Gene: PLAA
Chromosomal location: 9p21
Variant information

Variant position:  752
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Leucine (L) to Phenylalanine (F) at position 752 (L752F, p.Leu752Phe).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and hydrophobic (L) to large size and aromatic (F)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Neurodevelopmental disorder with progressive microcephaly, spasticity, and brain anomalies (NDMSBA) [MIM:617527]: An autosomal recessive neurodevelopmental disorder characterized by progressive microcephaly, spastic quadriparesis, global developmental delay, profound mental retardation and severely impaired or absent motor function. More variable features include seizures and optic atrophy. {ECO:0000269|PubMed:28007986, ECO:0000269|PubMed:28413018}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In NDMSBA; no effect on protein stability; no effect on subcellular localization; decreased function in positive regulation of cytosolic phospholipase A2 activity; in patient cells homozygous for the mutation.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  752
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  795
The length of the canonical sequence.

Location on the sequence:   ILEVVQDLEATFRLLVALGT  L ISDDSNAVQLAKSLGVDSQI
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         ILEVVQDLEATFRLLVALGTLISDDSNAVQLAKSLGVDSQI

Mouse                         ILEVVQDLEATFRLLVALGTLISDDSNAIQLAKSLGVDSQI

Rat                           ILEVVQDLEATFRLLVALGTLISDDSNAIQLAKSLGVDSQI

Xenopus laevis                VIEVVQDLEAIFRLLVALGTLISGDTNAMQLAKSLGVDSQI

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 795 Phospholipase A-2-activating protein
Domain 533 – 794 PUL
Repeat 716 – 755 ARM 5
Helix 739 – 753


Literature citations

Phospholipase A2-activating protein is associated with a novel form of leukoencephalopathy.
Falik Zaccai T.C.; Savitzki D.; Zivony-Elboum Y.; Vilboux T.; Fitts E.C.; Shoval Y.; Kalfon L.; Samra N.; Keren Z.; Gross B.; Chasnyk N.; Straussberg R.; Mullikin J.C.; Teer J.K.; Geiger D.; Kornitzer D.; Bitterman-Deutsch O.; Samson A.O.; Wakamiya M.; Peterson J.W.; Kirtley M.L.; Pinchuk I.V.; Baze W.B.; Gahl W.A.; Kleta R.; Anikster Y.; Chopra A.K.;
Brain 140:370-386(2017)
Cited for: VARIANT NDMSBA PHE-752; CHARACTERIZATION OF VARIANT NDMSBA PHE-752; FUNCTION; SUBCELLULAR LOCATION;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.