Home  |  Contact

UniProtKB/Swiss-Prot P61244: Variant p.Ser142Leu

Protein max
Gene: MAX
Variant information

Variant position:  142
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LB/B
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Serine (S) to Leucine (L) at position 142 (S142L, p.Ser142Leu).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from small size and polar (S) to medium size and hydrophobic (L)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  Does not affect MYC transcriptional activity.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  142
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  160
The length of the canonical sequence.

Location on the sequence:   LYTNAKGSTISAFDGGSDSS  S ESEPEEPQSRKKLRMEAS
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         LYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS--

Mouse                         LYTNAKGGTISAFDGGSDSSSESEPEEPQSRKKLRMEAS

Rat                           LYTNAKGGTISAFDGGSDSSSESEPEEPQNRKKLRMEAS

Cat                           LYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS

Chicken                       LYTNPKGSTISAFDGGSDSSSDSEPDEPQSRKKLRMEAS

Xenopus laevis                ------------------SSSESETEEPQSRKKLRMDAS

Zebrafish                     LYTNPKGQAVSAFDGGSDSSSGSEPEEQRTRKKHRPEDS

Drosophila                    -------------EVGSEEADDEDLDQDFSRRNKKMKTF

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 2 – 160 Protein max
Region 103 – 160 Disordered
Compositional bias 103 – 144 Polar residues
Modified residue 153 – 153 N6-acetyllysine
Modified residue 154 – 154 N6-acetyllysine
Alternative sequence 58 – 160 ASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS -> LYFLFWKLCTPVLHRQSLMQKCHTFISSYQVHKKKECKI. In isoform 5.
Alternative sequence 58 – 160 ASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS -> GTKMKLTLPPVFPYEHLPFPTVFCHG. In isoform 6.
Alternative sequence 99 – 160 VRALEKARSSAQLQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS -> GESES. In isoform 3.
Alternative sequence 99 – 160 VRALEKARSSAQLQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS -> GEHPSSWGSWPCCAPARSGFGTWACRVRASHGVCAQ. In isoform 4.
Mutagenesis 153 – 153 K -> Q. Loss of nuclear localization; when associated with Q-66 and Q-154. Kept nuclear localization; when associated with Q-154.
Mutagenesis 153 – 153 K -> R. Loss of acetylation, kept nuclear localization; when associated with R-66 and R-154.
Mutagenesis 154 – 154 K -> Q. Loss of nuclear localization; when associated with Q-66 and Q-153. Kept nuclear localization; when associated with Q-153.
Mutagenesis 154 – 154 K -> R. Loss of acetylation, kept nuclear localization; when associated with R-66 and R-153.


Literature citations

Exome sequencing identifies MAX mutations as a cause of hereditary pheochromocytoma.
Comino-Mendez I.; Gracia-Aznarez F.J.; Schiavi F.; Landa I.; Leandro-Garcia L.J.; Leton R.; Honrado E.; Ramos-Medina R.; Caronia D.; Pita G.; Gomez-Grana A.; de Cubas A.A.; Inglada-Perez L.; Maliszewska A.; Taschin E.; Bobisse S.; Pica G.; Loli P.; Hernandez-Lavado R.; Diaz J.A.; Gomez-Morales M.; Gonzalez-Neira A.; Roncador G.; Rodriguez-Antona C.; Benitez J.; Mannelli M.; Opocher G.; Robledo M.; Cascon A.;
Nat. Genet. 43:663-667(2011)
Cited for: INVOLVEMENT IN PCC; VARIANTS PCC ASN-23; 33-ARG--SER-160 DEL; 75-ARG--SER-160 DEL AND PRO-94; VARIANT LEU-142;

Functional and in silico assessment of MAX variants of unknown significance.
Comino-Mendez I.; Leandro-Garcia L.J.; Montoya G.; Inglada-Perez L.; de Cubas A.A.; Curras-Freixes M.; Tysoe C.; Izatt L.; Leton R.; Gomez-Grana A.; Mancikova V.; Apellaniz-Ruiz M.; Mannelli M.; Schiavi F.; Favier J.; Gimenez-Roqueplo A.P.; Timmers H.J.; Roncador G.; Garcia J.F.; Rodriguez-Antona C.; Robledo M.; Cascon A.;
J. Mol. Med. 93:1247-1255(2015)
Cited for: VARIANTS PCC LEU-9; ASN-23; TRP-25; 33-ARG--SER-160 DEL; CYS-35; TRP-60; SER-71; VAL-74; PRO-90; PRO-94; PRO-102 AND PRO-102; CHARACTERIZATION OF VARIANTS PCC LEU-9; ASN-23; TRP-25; 33-ARG--SER-160 DEL; CYS-35; TRP-60; SER-71; VAL-74; PRO-90; PRO-94 AND PRO-102; FUNCTION; VARIANTS THR-114 AND LEU-142; CHARACTERIZATION OF VARIANTS THR-114 AND LEU-142;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.