Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P40818: Variant p.Ser718Pro

Ubiquitin carboxyl-terminal hydrolase 8
Gene: USP8
Feedback?
Variant information Variant position: help 718 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help US The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Serine (S) to Proline (P) at position 718 (S718P, p.Ser718Pro). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from small size and polar (S) to medium size and hydrophobic (P) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In PITA4; uncertain significance; somatic mutation; localizes to nucleus instead of cytoplasm. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 718 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1118 The length of the canonical sequence.
Location on the sequence: help AKPQIPAERDREPSKLKRSY S SPDITQAIQEEEKRKPTVTP The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         AKPQIPAERDREPSKLKRSYSSPDITQAIQEEEKRKPTVTP

Mouse                         VKPQVPAERDREPSKLKRSYSSPDITQALQEEEKRRPAVTP

Baker's yeast                 -----------------------------------TKTMVP

Fission yeast                 --------------------------------EKYNQMVCL

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 1118 Ubiquitin carboxyl-terminal hydrolase 8
Region 679 – 746 Disordered
Compositional bias 716 – 726 Polar residues
Modified residue 718 – 718 Phosphoserine
Modified residue 719 – 719 Phosphoserine



Literature citations
Somatic USP8 gene mutations are a common cause of pediatric Cushing disease.
Faucz F.R.; Tirosh A.; Tatsi C.; Berthon A.; Hernandez-Ramirez L.C.; Settas N.; Angelousi A.; Correa R.; Papadakis G.Z.; Chittiboina P.; Quezado M.; Pankratz N.; Lane J.; Dimopoulos A.; Mills J.L.; Lodish M.; Stratakis C.A.;
J. Clin. Endocrinol. Metab. 102:2836-2843(2017)
Cited for: VARIANTS PITA4 718-SER--THR-723 DEL; CYS-718; PRO-718; SER-718 DEL AND ARG-720; CHARACTERIZATION OF VARIANT PITA4 PRO-718; SUBCELLULAR LOCATION;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.