Home  |  Contact

UniProtKB/Swiss-Prot P15260: Variant p.Cys85Tyr

Interferon gamma receptor 1
Gene: IFNGR1
Variant information

Variant position:  85
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Cysteine (C) to Tyrosine (Y) at position 85 (C85Y, p.Cys85Tyr).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (C) to large size and aromatic (Y)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Immunodeficiency 27A (IMD27A) [MIM:209950]: A form of Mendelian susceptibility to mycobacterial disease, a rare condition caused by impairment of interferon-gamma mediated immunity. It is characterized by predisposition to illness caused by moderately virulent mycobacterial species, such as Bacillus Calmette-Guerin (BCG) vaccine, environmental non-tuberculous mycobacteria, and by the more virulent Mycobacterium tuberculosis. Other microorganisms rarely cause severe clinical disease in individuals with susceptibility to mycobacterial infections, with the exception of Salmonella which infects less than 50% of these individuals. Clinical outcome severity depends on the degree of impairment of interferon-gamma mediated immunity. Some patients die of overwhelming mycobacterial disease with lepromatous-like lesions in early childhood, whereas others develop, later in life, disseminated but curable infections with tuberculoid granulomas. {ECO:0000269|PubMed:10811850, ECO:0000269|PubMed:11139207, ECO:0000269|PubMed:15589309, ECO:0000269|PubMed:16195661, ECO:0000269|PubMed:16715106, ECO:0000269|PubMed:17514500, ECO:0000269|PubMed:20015550, ECO:0000269|PubMed:20186794, ECO:0000269|PubMed:22708048, ECO:0000269|PubMed:25592983, ECO:0000269|PubMed:27868075, ECO:0000269|PubMed:28744922, ECO:0000269|PubMed:9389728}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In IMD27A; interferon-gamma-mediated signaling pathway completely abrogated.
Any additional useful information about the variant.



Sequence information

Variant position:  85
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  489
The length of the canonical sequence.

Location on the sequence:   NYGVKNSEWIDACINISHHY  C NISDHVGDPSNSLWVRVKAR
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         NYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKAR

Mouse                         VY---SGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAK

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 18 – 489 Interferon gamma receptor 1
Topological domain 18 – 245 Extracellular
Glycosylation 79 – 79 N-linked (GlcNAc...) asparagine
Glycosylation 86 – 86 N-linked (GlcNAc...) asparagine
Disulfide bond 77 – 85
Beta strand 74 – 86


Literature citations

Two patients with complete defects in interferon gamma receptor-dependent signaling.
Noordzij J.G.; Hartwig N.G.; Verreck F.A.; De Bruin-Versteeg S.; De Boer T.; Van Dissel J.T.; De Groot R.; Ottenhoff T.H.; Van Dongen J.J.;
J. Clin. Immunol. 27:490-496(2007)
Cited for: VARIANT IMD27A TYR-85; CHARACTERIZATION OF VARIANT IMD27A TYR-85;

Functional analysis of naturally occurring amino acid substitutions in human IFN-gammaR1.
van de Wetering D.; de Paus R.A.; van Dissel J.T.; van de Vosse E.;
Mol. Immunol. 47:1023-1030(2010)
Cited for: CHARACTERIZATION OF VARIANTS IMD27A GLU-61; GLY-63; CYS-66; PHE-77; TYR-77; TYR-85 AND THR-87; CHARACTERIZATION OF VARIANTS MET-14; ILE-61; LEU-149; PRO-335; MET-352 AND PRO-467; FUNCTION; MUTAGENESIS OF VAL-61;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.