Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9UHD2: Variant p.Gly159Ala

Serine/threonine-protein kinase TBK1
Gene: TBK1
Feedback?
Variant information Variant position: help 159 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Glycine (G) to Alanine (A) at position 159 (G159A, p.Gly159Ala). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to small size and hydrophobic (A) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In IIAE8; loss of kinase activity; loss of autophosphorylation at S-172; loss of IFNB induction. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 159 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 729 The length of the canonical sequence.
Location on the sequence: help GNIMRVIGEDGQSVYKLTDF G AARELEDDEQFVSLYGTEEY The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         GNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEY

Mouse                         GNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEY

Xenopus laevis                GNIMREIGEDGKSVYKLTDFGAARELEDDEQFVSLYGTEEY

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 729 Serine/threonine-protein kinase TBK1
Domain 9 – 310 Protein kinase
Modified residue 172 – 172 Phosphoserine; by autocatalysis and IKKB
Mutagenesis 172 – 172 S -> A. Loss of kinase activity. No effect on dimerization. Loss of USP38-mediated degradation.
Mutagenesis 172 – 172 S -> E. Decreased kinase activity.
Helix 158 – 160



Literature citations
Heterozygous TBK1 mutations impair TLR3 immunity and underlie herpes simplex encephalitis of childhood.
Herman M.; Ciancanelli M.; Ou Y.H.; Lorenzo L.; Klaudel-Dreszler M.; Pauwels E.; Sancho-Shimizu V.; Perez de Diego R.; Abhyankar A.; Israelsson E.; Guo Y.; Cardon A.; Rozenberg F.; Lebon P.; Tardieu M.; Heropolitanska-Pliszka E.; Chaussabel D.; White M.A.; Abel L.; Zhang S.Y.; Casanova J.L.;
J. Exp. Med. 209:1567-1582(2012)
Cited for: INVOLVEMENT IN IIAE8; VARIANTS IIAE8 ALA-50 AND ALA-159; CHARACTERIZATION OF VARIANTS IIAE8 ALA-50 AND ALA-159; MUTAGENESIS OF LYS-38; PHOSPHORYLATION AT SER-172; FUNCTION;
Inborn errors of type I IFN immunity in patients with life-threatening COVID-19.
Zhang Q.; Bastard P.; Liu Z.; Le Pen J.; Moncada-Velez M.; Chen J.; Ogishi M.; Sabli I.K.D.; Hodeib S.; Korol C.; Rosain J.; Bilguvar K.; Ye J.; Bolze A.; Bigio B.; Yang R.; Arias A.A.; Zhou Q.; Zhang Y.; Onodi F.; Korniotis S.; Karpf L.; Philippot Q.; Chbihi M.; Bonnet-Madin L.; Dorgham K.; Smith N.; Schneider W.M.; Razooky B.S.; Hoffmann H.H.; Michailidis E.; Moens L.; Han J.E.; Lorenzo L.; Bizien L.; Meade P.; Neehus A.L.; Ugurbil A.C.; Corneau A.; Kerner G.; Zhang P.; Rapaport F.; Seeleuthner Y.; Manry J.; Masson C.; Schmitt Y.; Schlueter A.; Le Voyer T.; Khan T.; Li J.; Fellay J.; Roussel L.; Shahrooei M.; Alosaimi M.F.; Mansouri D.; Al-Saud H.; Al-Mulla F.; Almourfi F.; Al-Muhsen S.Z.; Alsohime F.; Al Turki S.; Hasanato R.; van de Beek D.; Biondi A.; Bettini L.R.; D'Angio' M.; Bonfanti P.; Imberti L.; Sottini A.; Paghera S.; Quiros-Roldan E.; Rossi C.; Oler A.J.; Tompkins M.F.; Alba C.; Vandernoot I.; Goffard J.C.; Smits G.; Migeotte I.; Haerynck F.; Soler-Palacin P.; Martin-Nalda A.; Colobran R.; Morange P.E.; Keles S.; Coelkesen F.; Ozcelik T.; Yasar K.K.; Senoglu S.; Karabela S.N.; Rodriguez-Gallego C.; Novelli G.; Hraiech S.; Tandjaoui-Lambiotte Y.; Duval X.; Laouenan C.; Snow A.L.; Dalgard C.L.; Milner J.D.; Vinh D.C.; Mogensen T.H.; Marr N.; Spaan A.N.; Boisson B.; Boisson-Dupuis S.; Bustamante J.; Puel A.; Ciancanelli M.J.; Meyts I.; Maniatis T.; Soumelis V.; Amara A.; Nussenzweig M.; Garcia-Sastre A.; Krammer F.; Pujol A.; Duffy D.; Lifton R.P.; Zhang S.Y.; Gorochov G.; Beziat V.; Jouanguy E.; Sancho-Shimizu V.; Rice C.M.; Abel L.; Notarangelo L.D.; Cobat A.; Su H.C.; Casanova J.L.;
Science 370:0-0(2020)
Cited for: VARIANTS SER-24; LEU-152; ALA-159; 308-ARG--LEU-729 DEL; GLN-384; SER-388; THR-397; ILE-508; MET-522; THR-533; GLN-653 AND SER-659; CHARACTERIZATION OF VARIANTS SER-24; LEU-152; ALA-159; 308-ARG--LEU-729 DEL; GLN-384; SER-388; THR-397; ILE-508; MET-522; THR-533; GLN-653 AND SER-659; FUNCTION;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.