UniProtKB/Swiss-Prot Q9UHD2: Variant p.Ile207Val

Serine/threonine-protein kinase TBK1
Gene: TBK1
Feedback?

Variant information Variant position:

207 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

US The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Isoleucine (I) to Valine (V) at position 207 (I207V, p.Ile207Val). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description:

In IIAE8; uncertain significance. Any additional useful information about the variant.
Other resources:

Links to websites of interest for the variant.

Variant rs1555203557 [ dbSNP | Ensembl ]

Sequence information Variant position:

207 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

729 The length of the canonical sequence.
Location on the sequence:

RAVLRKDHQKKYGATVDLWS I GVTFYHAATGSLPFRPFEGP The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         RAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGP

Mouse                         RAVLRKDHQKKYGATVDLWSVGVTFYHAATGSLPFRPFEGP

Xenopus laevis                RAVLRKEHQKKYSATVDLWSIGVTFYHAATGSLPFRPFEGP

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 729	Serine/threonine-protein kinase TBK1
Domain	9 – 310	Protein kinase
Helix	202 – 216

Literature citations
Mutations in the TLR3 signaling pathway and beyond in adult patients with herpes simplex encephalitis.
Moerk N.; Kofod-Olsen E.; Soerensen K.B.; Bach E.; Oerntoft T.F.; Oestergaard L.; Paludan S.R.; Christiansen M.; Mogensen T.H.;
Genes Immun. 16:552-566(2015)
Cited for: INVOLVEMENT IN IIAE8; VARIANT IIAE8 VAL-207;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.