Home  |  Contact
Due to work on this service, it may not be fully operational on Wednesday March 20 between 1.30 pm and 2.30 pm CEST. Apologies for the inconvenience.

UniProtKB/Swiss-Prot P47870: Variant p.Thr287Pro

Gamma-aminobutyric acid receptor subunit beta-2
Gene: GABRB2
Chromosomal location: 5q34
Variant information

Variant position:  287
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Threonine (T) to Proline (P) at position 287 (T287P, p.Thr287Pro).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (T) to medium size and hydrophobic (P)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Epileptic encephalopathy, infantile or early childhood, 2 (IECEE2) [MIM:617829]: A form of epileptic encephalopathy, a heterogeneous group of severe childhood onset epilepsies characterized by refractory seizures, neurodevelopmental impairment, and poor prognosis. Development is normal prior to seizure onset, after which cognitive and motor delays become apparent. IECEE2 is an autosomal dominant condition with variable age at seizure onset, ranging from early infancy to 6 years. {ECO:0000269|PubMed:25124326, ECO:0000269|PubMed:27789573, ECO:0000269|PubMed:29100083}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In IECEE2; loss of localization to the cell membrane; retained intracellularly it affects the cell surface expression of the GABA receptor; decreased GABA receptor activity.
Any additional useful information about the variant.



Sequence information

Variant position:  287
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  512
The length of the canonical sequence.

Location on the sequence:   NYDASAARVALGITTVLTMT  T INTHLRETLPKIPYVKAIDM
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         NYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDM

Rhesus macaque                NYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDM

Mouse                         NYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDM

Rat                           NYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDM

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 26 – 512 Gamma-aminobutyric acid receptor subunit beta-2
Transmembrane 270 – 292 Helical


Literature citations

A de novo missense mutation of GABRB2 causes early myoclonic encephalopathy.
Ishii A.; Kang J.Q.; Schornak C.C.; Hernandez C.C.; Shen W.; Watkins J.C.; Macdonald R.L.; Hirose S.;
J. Med. Genet. 54:202-211(2017)
Cited for: VARIANT IECEE2 PRO-287; CHARACTERIZATION OF VARIANT IECEE2 PRO-287; FUNCTION;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.