Home  |  Contact

UniProtKB/Swiss-Prot Q15043: Variant p.Leu441Arg

Zinc transporter ZIP14
Gene: SLC39A14
Variant information

Variant position:  441
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Leucine (L) to Arginine (R) at position 441 (L441R, p.Leu441Arg).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and hydrophobic (L) to large size and basic (R)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Hyperostosis cranialis interna (HCIN) [MIM:144755]: An autosomal dominant bone disorder characterized by endosteal hyperostosis and osteosclerosis of the calvaria and the skull base. The progressive bone overgrowth causes entrapment and dysfunction of cranial nerves I, II, V, VII, and VIII, its first symptoms often presenting during the second decade of life. {ECO:0000269|PubMed:29621230}. Note=The disease is caused by mutations affecting the gene represented in this entry. Conditional knockin mice overexpressing Arg-438 variant, which is the mouse equivalent of human variant Leu-441, in osteoblasts have a severe skeletal phenotype marked by a drastic increase in cortical thickness due to an enhanced endosteal bone formation, resembling the underlying pathology in HCI patients. {ECO:0000269|PubMed:29621230}.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In HCIN; loss of localization at the plasma membrane; loss of Zn uptake activity.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  441
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  492
The length of the canonical sequence.

Location on the sequence:   SHFSANWIFALAGGMFLYIS  L ADMFPEMNEVCQEDERKGSI
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         SHFSANWIFALAGGMFLYISLADMFPEMNEVCQEDERKG--SI

Mouse                         SHFSANWIFALAGGMFLYIALADMFPEMNEVCQEDEKND--

Bovine                        SHFSANWIFALAGGMFLYISLADMFPEMNEVSQEDERKG--

Xenopus tropicalis            SHFSSNWIFALAGGMFLYIALSDMFPEMNEVSKEDEEGG--

Zebrafish                     NNFSPNWIFALAGGMFLYIALADMFPEMNEVSREEEEAGGS

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 31 – 492 Zinc transporter ZIP14
Transmembrane 425 – 445 Helical


Literature citations

Conditional mouse models support the role of SLC39A14 (ZIP14) in Hyperostosis Cranialis Interna and in bone homeostasis.
Hendrickx G.; Borra V.M.; Steenackers E.; Yorgan T.A.; Hermans C.; Boudin E.; Waterval J.J.; Jansen I.D.C.; Aydemir T.B.; Kamerling N.; Behets G.J.; Plumeyer C.; D'Haese P.C.; Busse B.; Everts V.; Lammens M.; Mortier G.; Cousins R.J.; Schinke T.; Stokroos R.J.; Manni J.J.; Van Hul W.;
PLoS Genet. 14:E1007321-E1007321(2018)
Cited for: INVOLVEMENT IN HCIN; VARIANT HCIN ARG-441; CHARACTERIZATION OF VARIANT HCIN ARG-441; FUNCTION; SUBCELLULAR LOCATION; TISSUE SPECIFICITY;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.