UniProtKB/Swiss-Prot O00499: Variant p.Arg24Cys

Myc box-dependent-interacting protein 1
Gene: BIN1
Feedback?

Variant information Variant position:

24 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

US The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Arginine (R) to Cysteine (C) at position 24 (R24C, p.Arg24Cys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from large size and basic (R) to medium size and polar (C) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description:

Found in a sporadic case of centronulear myopathy; uncertain significance; does not induce membrane tubulation in cultured cells. Any additional useful information about the variant.

Sequence information Variant position:

24 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

593 The length of the canonical sequence.
Location on the sequence:

MGSKGVTAGKIASNVQKKLT R AQEKVLQKLGKADETKDEQF The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         MGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQF

Mouse                         MGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQF

Rat                           MGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQF

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	2 – 593	Myc box-dependent-interacting protein 1
Region	2 – 122	Interaction with BIN2
Coiled coil	15 – 42
Helix	8 – 33

Literature citations
Adult-onset autosomal dominant centronuclear myopathy due to BIN1 mutations.
Boehm J.; Biancalana V.; Malfatti E.; Dondaine N.; Koch C.; Vasli N.; Kress W.; Strittmatter M.; Taratuto A.L.; Gonorazky H.; Laforet P.; Maisonobe T.; Olive M.; Gonzalez-Mera L.; Fardeau M.; Carriere N.; Clavelou P.; Eymard B.; Bitoun M.; Rendu J.; Faure J.; Weis J.; Mandel J.L.; Romero N.B.; Laporte J.;
Brain 137:3160-3170(2014)
Cited for: INVOLVEMENT IN AUTOSOMAL DOMINANT CENTRONUCLEAR MYOPATHY; VARIANTS LYS-21 DEL AND CYS-24;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.