Home  |  Contact

UniProtKB/Swiss-Prot O43497: Variant p.Ala961Thr

Voltage-dependent T-type calcium channel subunit alpha-1G
Gene: CACNA1G
Variant information

Variant position:  961
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Alanine (A) to Threonine (T) at position 961 (A961T, p.Ala961Thr).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from small size and hydrophobic (A) to medium size and polar (T)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Spinocerebellar ataxia 42, early-onset, severe, with neurodevelopmental deficits (SCA42ND) [MIM:618087]: A form of spinocerebellar ataxia, a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA42ND is an early-onset, severe form associated with motor and cognitive impairment, cerebellar atrophy as well as variable features such as facial dysmorphisms, digital anomalies, microcephaly and epilepsy. SCA42ND inheritance is autosomal dominant. {ECO:0000269|PubMed:29878067}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In SCA42ND; gain-of-function mutation; results in slower channel inactivation and negatively shifted potential for half-inactivation.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  961
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  2377
The length of the canonical sequence.

Location on the sequence:   ALYFIALMTFGNYVLFNLLV  A ILVEGFQAEEISKREDASGQ
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         ALYFIALMTFGNYVLFNLLVAILVEGFQAEEISKREDASGQ

Rat                           ALYFIALMTFGNYVLFNLLVAILVEGFQAE-----------

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 2377 Voltage-dependent T-type calcium channel subunit alpha-1G
Transmembrane 940 – 964 Helical; Name=S6 of repeat II
Repeat 729 – 967 II
Helix 955 – 967


Literature citations

De novo mutation screening in childhood-onset cerebellar atrophy identifies gain-of-function mutations in the CACNA1G calcium channel gene.
Chemin J.; Siquier-Pernet K.; Nicouleau M.; Barcia G.; Ahmad A.; Medina-Cano D.; Hanein S.; Altin N.; Hubert L.; Bole-Feysot C.; Fourage C.; Nitschke P.; Thevenon J.; Rio M.; Blanc P.; Vidal C.; Bahi-Buisson N.; Desguerre I.; Munnich A.; Lyonnet S.; Boddaert N.; Fassi E.; Shinawi M.; Zimmerman H.; Amiel J.; Faivre L.; Colleaux L.; Lory P.; Cantagrel V.;
Brain 141:1998-2013(2018)
Cited for: INVOLVEMENT IN SCA42ND; FUNCTION; VARIANTS SCA42ND THR-961 AND VAL-1531; CHARACTERIZATION OF VARIANTS SCA42ND THR-961 AND VAL-1531;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.