UniProtKB/Swiss-Prot Q9NX46: Variant p.Val335Gly

ADP-ribosylhydrolase ARH3
Gene: ADPRS
Feedback?

Variant information Variant position:

335 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

US The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Valine (V) to Glycine (G) at position 335 (V335G, p.Val335Gly). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and hydrophobic (V) to glycine (G) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description:

In CONDSIAS; uncertain significance; results in accumulation of poly(ADP-ribose) in the nucleus of patient cells after exposure to H(2)O(2); reduced protein abundance in fibroblasts; localization to the cytoplasm in fibroblasts; no effect on hydrolase activity in vitro; may result in reduced protein stability. Any additional useful information about the variant.
Other resources:

Links to websites of interest for the variant.

Variant rs201735454 [ dbSNP | Ensembl ]

Sequence information Variant position:

335 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

363 The length of the canonical sequence.
Location on the sequence:

TDTIATMAGAIAGAYYGMDQ V PESWQQSCEGYEETDILAQS The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         TDTIATMAGAIAGAYYGMDQVPESWQQSCEGYEETDILAQS

Mouse                         TDTIATMAGAIAGAYYGMEQVPESWQQSCEGFEETDVLAQS

Bovine                        TDTIATMAGAIAGAYYGMEQVPESWQQSCEGYEETDVLAQS

Chicken                       TNTIATMAGAIAGAYYGEEQVPPSWEQSCEAFQETQKMANS

Xenopus tropicalis            TDTIATMAAAIAGAYHGEEQIPLNWKLSAEGYKDAEDWGEK

Zebrafish                     TDTIACMAGAIAGAHYGIDSIPLSWQVSCEGVDEADDLARR

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 363	ADP-ribosylhydrolase ARH3
Binding site	316 – 316
Binding site	316 – 316
Binding site	317 – 317
Mutagenesis	316 – 316	D -> A. Abolishes hydrolase activity.
Mutagenesis	317 – 317	T -> A. Complete loss of activity. Does not affect recruitment to DNA lesion regions following DNA damage. Retains ability to bind proteins ADP-ribosylated on serine but is unable to hydrolyze them.
Mutagenesis	317 – 317	T -> S. Partial loss of activity.

Literature citations
Bi-allelic ADPRHL2 mutations cause neurodegeneration with developmental delay, ataxia, and axonal neuropathy.
Danhauser K.; Alhaddad B.; Makowski C.; Piekutowska-Abramczuk D.; Syrbe S.; Gomez-Ospina N.; Manning M.A.; Kostera-Pruszczyk A.; Krahn-Peper C.; Berutti R.; Kovacs-Nagy R.; Gusic M.; Graf E.; Laugwitz L.; Roeblitz M.; Wroblewski A.; Hartmann H.; Das A.M.; Bueltmann E.; Fang F.; Xu M.; Schatz U.A.; Karall D.; Zellner H.; Haberlandt E.; Feichtinger R.G.; Mayr J.A.; Meitinger T.; Prokisch H.; Strom T.M.; Ploski R.; Hoffmann G.F.; Pronicki M.; Bonnen P.E.; Morlot S.; Haack T.B.;
Am. J. Hum. Genet. 103:817-825(2018)
Cited for: INVOLVEMENT IN CONDSIAS; VARIANTS CONDSIAS 248-LYS-ILE-249 DELINS ASN; GLY-335 AND 346-TYR--SER-363 DEL; FUNCTION; CHARACTERIZATION OF VARIANTS CONDSIAS 248-LYS-ILE-249 DELINS ASN AND GLY-335; Biallelic ADPRHL2 mutations in complex neuropathy affect ADP ribosylation and DNA damage response.
Beijer D.; Agnew T.; Rack J.G.M.; Prokhorova E.; Deconinck T.; Ceulemans B.; Peric S.; Milic Rasic V.; De Jonghe P.; Ahel I.; Baets J.;
Life. Sci Alliance 4:0-0(2021)
Cited for: CHARACTERIZATION OF VARIANTS CONDSIAS PHE-26 AND GLY-335; FUNCTION; SUBCELLULAR LOCATION; MUTAGENESIS OF ASP-77 AND ASP-78;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.