UniProtKB/Swiss-Prot P61964: Variant p.Thr208Met

WD repeat-containing protein 5
Gene: WDR5
Feedback?

Variant information Variant position:

208 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

US The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Threonine (T) to Methionine (M) at position 208 (T208M, p.Thr208Met). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and polar (T) to medium size and hydrophobic (M) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description:

Found in a patient with childhood apraxia of speech; uncertain significance. Any additional useful information about the variant.

Sequence information Variant position:

208 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

334 The length of the canonical sequence.
Location on the sequence:

SSSYDGLCRIWDTASGQCLK T LIDDDNPPVSFVKFSPNGKY The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         SSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKY

Mouse                         SSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKY

Rat                           SSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKY

Bovine                        SSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKY

Xenopus tropicalis            SSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKY

Slime mold                    SGSYDGTVRIWDTTTGQLLNTISTEDGKEVSFVKFSPNGKF

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	2 – 334	WD repeat-containing protein 5
Repeat	169 – 208	WD 4
Mutagenesis	225 – 225	N -> A. Loss of interaction with RBBP5 and reduced ability to stimulate KMT2A methyltransferase activity in association with RBBP5 and ASH2L.
Beta strand	205 – 211

Literature citations
A set of regulatory genes co-expressed in embryonic human brain is implicated in disrupted speech development.
Eising E.; Carrion-Castillo A.; Vino A.; Strand E.A.; Jakielski K.J.; Scerri T.S.; Hildebrand M.S.; Webster R.; Ma A.; Mazoyer B.; Francks C.; Bahlo M.; Scheffer I.E.; Morgan A.T.; Shriberg L.D.; Fisher S.E.;
Mol. Psychiatry 24:1065-1078(2019)
Cited for: VARIANT MET-208;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.