Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O94925: Variant p.Pro313Leu

Glutaminase kidney isoform, mitochondrial
Gene: GLS
Feedback?
Variant information Variant position: help 313 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Proline (P) to Leucine (L) at position 313 (P313L, p.Pro313Leu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In GDPAG; loss of enzyme activity. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 313 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 669 The length of the canonical sequence.
Location on the sequence: help YAIAVNDLGTEYVHRYVGKE P SGLRFNKLFLNEDDKPHNPM The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         YAIAVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPM

Mouse                         YAIAVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPM

Rat                           YAIAVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPM

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 55 – 669 Glutaminase kidney isoform, mitochondrial 68 kDa chain
Chain 73 – 669 Glutaminase kidney isoform, mitochondrial 65 kDa chain
Modified residue 311 – 311 N6-acetyllysine
Alternative sequence 170 – 669 Missing. In isoform 2.
Mutagenesis 318 – 318 F -> Y. No effect on catalytic activity. Loss of inhibition by BPTES; when associated with S-322.
Mutagenesis 321 – 321 L -> A. Decreased enzyme activity.
Mutagenesis 322 – 322 F -> S. No effect on catalytic activity. Loss of inhibition by BPTES; when associated with Y-318.
Mutagenesis 323 – 323 L -> A. Decreased enzyme activity.
Helix 313 – 315



Literature citations
Glutaminase deficiency caused by short tandem repeat expansion in GLS.
van Kuilenburg A.B.P.; Tarailo-Graovac M.; Richmond P.A.; Droegemoeller B.I.; Pouladi M.A.; Leen R.; Brand-Arzamendi K.; Dobritzsch D.; Dolzhenko E.; Eberle M.A.; Hayward B.; Jones M.J.; Karbassi F.; Kobor M.S.; Koster J.; Kumari D.; Li M.; MacIsaac J.; McDonald C.; Meijer J.; Nguyen C.; Rajan-Babu I.S.; Scherer S.W.; Sim B.; Trost B.; Tseng L.A.; Turkenburg M.; van Vugt J.J.F.A.; Veldink J.H.; Walia J.S.; Wang Y.; van Weeghel M.; Wright G.E.B.; Xu X.; Yuen R.K.C.; Zhang J.; Ross C.J.; Wasserman W.W.; Geraghty M.T.; Santra S.; Wanders R.J.A.; Wen X.Y.; Waterham H.R.; Usdin K.; van Karnebeek C.D.M.;
N. Engl. J. Med. 380:1433-1441(2019)
Cited for: FUNCTION; INVOLVEMENT IN GDPAG; VARIANT GDPAG LEU-313; CHARACTERIZATION OF VARIANT GDPAG LEU-313;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.