Home  |  Contact

UniProtKB/Swiss-Prot Q9NYG8: Variant p.Ala244Pro

Potassium channel subfamily K member 4
Gene: KCNK4
Variant information

Variant position:  244
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LP/P [Disclaimer]
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Alanine (A) to Proline (P) at position 244 (A244P, p.Ala244Pro).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from small size and hydrophobic (A) to medium size and hydrophobic (P)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  In FHEIG; gain-of-function variant resulting in highly increased basal potassium currents; impaired sensitivity to arachidonic acid.
Any additional useful information about the variant.



Sequence information

Variant position:  244
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  393
The length of the canonical sequence.

Location on the sequence:   PRQDSPAYQPLVWFWILLGL  A YFASVLTTIGNWLRVVSRRT
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         PRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVVSRRT

Mouse                         TGQNSPAYQPLVWFWILFGLAYFASVLTTIGNWLRAVSRRT

Rat                           TGQNSPAYQPLVWFWILFGLAYFASVLTTIGNWLRAVSRRT

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 393 Potassium channel subfamily K member 4
Transmembrane 234 – 260 Helical
Mutagenesis 236 – 236 W -> S. Increases basal level of channel activity and decreases further activation by pressure, but has little effect on further activation by arachidonic acid.
Helix 231 – 259


Literature citations

Mutations in KCNK4 that affect gating cause a recognizable neurodevelopmental syndrome.
Bauer C.K.; Calligari P.; Radio F.C.; Caputo V.; Dentici M.L.; Falah N.; High F.; Pantaleoni F.; Barresi S.; Ciolfi A.; Pizzi S.; Bruselles A.; Person R.; Richards S.; Cho M.T.; Claps Sepulveda D.J.; Pro S.; Battini R.; Zampino G.; Digilio M.C.; Bocchinfuso G.; Dallapiccola B.; Stella L.; Tartaglia M.;
Am. J. Hum. Genet. 103:621-630(2018)
Cited for: FUNCTION; ACTIVITY REGULATION; INVOLVEMENT IN FHEIG; VARIANTS FHEIG GLU-172 AND PRO-244; CHARACTERIZATION OF VARIANTS FHEIG GLU-172 AND PRO-244;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.