Home  |  Contact

UniProtKB/Swiss-Prot Q14703: Variant p.Asp365Gly

Membrane-bound transcription factor site-1 protease
Gene: MBTPS1
Variant information

Variant position:  365
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LP/P [Disclaimer]
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Aspartate (D) to Glycine (G) at position 365 (D365G, p.Asp365Gly).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and acidic (D) to glycine (G)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  In SEDKF; due to a nucleotide substitution that creates a dominant splice donor site in exon 9; two different type of transcripts are produced, a major non-functional alternatively spliced transcript with a 41-bp deletion of exon 9, loss of S-414 in the catalytic triad and premature truncation and a normally spliced transcript with variant G-365; the transcript with G-365 produces a catalytically active protein but is the less abundant.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  365
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1052
The length of the canonical sequence.

Location on the sequence:   TLNNPADQMDVIGVGGIDFE  D NIARFSSRGMTTWELPGGYG
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         TLNNPADQMDVIGVGGIDFEDNIARFSSRGMTTWELPGGYG

Mouse                         TLNNPADQMDVIGVGGIDFEDNIARFSSRGMTTWELPGGYG

Rat                           TLNNPADQMDVIGVGGIDFEDNIARFSSRGMTTWELPGGYG

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 187 – 1052 Membrane-bound transcription factor site-1 protease
Topological domain 187 – 998 Lumenal
Domain 190 – 472 Peptidase S8


Literature citations

Site-1 protease deficiency causes human skeletal dysplasia due to defective inter-organelle protein trafficking.
Kondo Y.; Fu J.; Wang H.; Hoover C.; McDaniel J.M.; Steet R.; Patra D.; Song J.; Pollard L.; Cathey S.; Yago T.; Wiley G.; Macwana S.; Guthridge J.; McGee S.; Li S.; Griffin C.; Furukawa K.; James J.A.; Ruan C.; McEver R.P.; Wierenga K.J.; Gaffney P.M.; Xia L.;
JCI Insight 3:0-0(2018)
Cited for: FUNCTION; INVOLVEMENT IN SEDKF; MUTAGENESIS OF SER-414; VARIANT SEDKF GLY-365;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.