Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P39210: Variant p.Gln93Pro

Protein Mpv17
Gene: MPV17
Feedback?
Variant information Variant position: help 93 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Glutamine (Q) to Proline (P) at position 93 (Q93P, p.Gln93Pro). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (Q) to medium size and hydrophobic (P) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In MTDPS6; results in altered ribonucleotide incorporation in mtDNA from patient fibroblasts. Any additional useful information about the variant.


Sequence information Variant position: help 93 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 176 The length of the canonical sequence.
Location on the sequence: help LDRFIPGTTKVDALKKMLLD Q GGFAPCFLGCFLPLVGALNG The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         LDRFIPGTTKV--DALKKMLLDQGGFAPCFLGCFLPLVGALNG

Mouse                         LDHLIPGTTKV--HALKKMLLDQGGFAPCFLGCFLPLVGIL

Rat                           LDHLIPGTTKV--NALKKMLLDQGGFAPCFLGCFLPLVGVL

Bovine                        LDRLIPGTTKV--DALKKMLLDQGGFAPCFLGCFLPLVGTL

Xenopus laevis                LDRIIPGSGKP--VALKKMLLDQVAFAPCFLGCFLSIASAL

Zebrafish                     LDKLVTGGTKS--AALKKMLVDQVGFAPCFLGAFLGITGTL

Caenorhabditis elegans        LEKVKGNNKSL--LLVKKLCIDQLCFSPCFNAAILFNLRLL

Drosophila                    LESRVPKTYSPMRRGVTKMLVDQTLFAPPFTMAMSFLVPLS
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 176 Protein Mpv17
Site 92 – 92 Determines ion selectivity
Mutagenesis 80 – 80 T -> A. Does not affect gating properties of the channel.
Mutagenesis 92 – 92 D -> K. Affects ion selectivity of the channel.
Mutagenesis 99 – 99 C -> A. Does not affect conductance and gating properties of the channel.



Literature citations
Clinical, biochemical, cellular and molecular characterization of mitochondrial DNA depletion syndrome due to novel mutations in the MPV17 gene.
Uusimaa J.; Evans J.; Smith C.; Butterworth A.; Craig K.; Ashley N.; Liao C.; Carver J.; Diot A.; Macleod L.; Hargreaves I.; Al-Hussaini A.; Faqeih E.; Asery A.; Al Balwi M.; Eyaid W.; Al-Sunaid A.; Kelly D.; van Mourik I.; Ball S.; Jarvis J.; Mulay A.; Hadzic N.; Samyn M.; Baker A.; Rahman S.; Stewart H.; Morris A.A.; Seller A.; Fratter C.; Taylor R.W.; Poulton J.;
Eur. J. Hum. Genet. 22:184-191(2014)
Cited for: VARIANTS MTDPS6 ARG-21; PRO-23; PRO-36; TRP-41; 44-GLN--LEU-176 DEL; ARG-64; PRO-93 AND LEU-98; Nucleotide pools dictate the identity and frequency of ribonucleotide incorporation in mitochondrial DNA.
Berglund A.K.; Navarrete C.; Engqvist M.K.; Hoberg E.; Szilagyi Z.; Taylor R.W.; Gustafsson C.M.; Falkenberg M.; Clausen A.R.;
PLoS Genet. 13:E1006628-E1006628(2017)
Cited for: CHARACTERIZATION OF VARIANTS MTDPS6 PRO-23 AND PRO-93; MPV17-related mitochondrial DNA maintenance defect: New cases and review of clinical, biochemical, and molecular aspects.
El-Hattab A.W.; Wang J.; Dai H.; Almannai M.; Staufner C.; Alfadhel M.; Gambello M.J.; Prasun P.; Raza S.; Lyons H.J.; Afqi M.; Saleh M.A.M.; Faqeih E.A.; Alzaidan H.I.; Alshenqiti A.; Flore L.A.; Hertecant J.; Sacharow S.; Barbouth D.S.; Murayama K.; Shah A.A.; Lin H.C.; Wong L.C.;
Hum. Mutat. 39:461-470(2018)
Cited for: VARIANTS MTDPS6 ARG-21; TRP-50; LYS-88 DEL; LEU-91 DEL; GLY-92; PRO-93; ASP-95; LEU-98; 99-CYS--LEU-176 DEL AND MET-154;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.