Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P40189: Variant p.Pro498Leu

Interleukin-6 receptor subunit beta
Gene: IL6ST
Feedback?
Variant information Variant position: help 498 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Proline (P) to Leucine (L) at position 498 (P498L, p.Pro498Leu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In HIES4B; results in defective cytokine-mediated signaling pathway. Any additional useful information about the variant.


Sequence information Variant position: help 498 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 918 The length of the canonical sequence.
Location on the sequence: help HRTYLRGNLAESKCYLITVT P VYADGPGSPESIKAYLKQAP The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         HRTYLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAP

Mouse                         NRTHLRGRLLESKCYQITVTPVFATGPGGSESLKAYLKQAA

Rat                           NRTHLRGSLLESKCYLITVTPVFPGGPGSPESMKAYLKQAA
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 23 – 918 Interleukin-6 receptor subunit beta
Topological domain 23 – 619 Extracellular
Domain 426 – 517 Fibronectin type-III 4
Alternative sequence 330 – 918 Missing. In isoform 2.
Beta strand 491 – 500



Literature citations
Selective loss of function variants in IL6ST cause Hyper-IgE syndrome with distinct impairments of T-cell phenotype and function.
Shahin T.; Aschenbrenner D.; Cagdas D.; Bal S.K.; Conde C.D.; Garncarz W.; Medgyesi D.; Schwerd T.; Karaatmaca B.; Cetinkaya P.G.; Esenboga S.; Twigg S.R.F.; Cant A.; Wilkie A.O.M.; Tezcan I.; Uhlig H.H.; Boztug K.;
Haematologica 104:609-621(2019)
Cited for: VARIANT HIES4B LEU-498; INVOLVEMENT IN HIES4B; FUNCTION; CHARACTERIZATION OF VARIANT HIES4B LEU-498;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.