UniProtKB/Swiss-Prot P09917: Variant p.Thr591Met

Polyunsaturated fatty acid 5-lipoxygenase
Gene: ALOX5
Feedback?

Variant information Variant position:

591 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

US The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Threonine (T) to Methionine (M) at position 591 (T591M, p.Thr591Met). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and polar (T) to medium size and hydrophobic (M) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Variant description:

Increases arachidonate 5-lipoxygenase activity. Does not affect leukotriene A4 synthase activity. Any additional useful information about the variant.

Sequence information Variant position:

591 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

674 The length of the canonical sequence.
Location on the sequence:

TMRAPPPTAKGVVTIEQIVD T LPDRGRSCWHLGAVWALSQF The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         TMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQF

Mouse                         TMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQF

Rat                           TMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQF

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 674	Polyunsaturated fatty acid 5-lipoxygenase
Domain	119 – 674	Lipoxygenase
Alternative sequence	485 – 674	Missing. In isoform 5.
Alternative sequence	534 – 674	Missing. In isoform 4.
Alternative sequence	559 – 615	Missing. In isoform 2.
Mutagenesis	604 – 604	A -> I. Loss of (5S)-lipoxygenase activity. Loss of (5S)-lipoxygenase activity; when associated with W-360; I-425 and M-426. Exhibits a major (15S)-lipoxygenase activity;when associated with W-360; I-425 and M-426. Does not catalyze oxygenation of arachodonic acid to 5-HETE; when associated with W-360; I-425 and M-426. Catalyzes oxygenation of arachodonic acid to form in majority (15S)-HETE and (8S)-HETE but also 12-HETE; when associated with W-360; I-425 and M-426. Abolishes the LTA4-synthase activity; when associated with W-360; I-425 and M-426. Catalyzes oxygenation of linoleic acid to (13S)- and (9 S)-HODE; when associated with W-360; I-425 and M-426. Catalyzes oxygenation of (11S)- and (11R)-deutero-linoleic acid to 9-HODE and (13S)-HODE respectively; when associated with W-360; I-425 and M-426. Catalyzes oxygenation of alpha-linolenic acid (ALA) to 13-HOTrE(n-3); when associated with W-360; I-425 and M-426. Catalyzes oxygenation of gamma-linolenic acid (GLA) to 13-HOTrE(n-6) and 10-HOTrE; when associated with W-360; I-425 and M-426. Catalyzes the oxygenation of eicosapentaenoic acid (EPA) to 12- and 15-HEPA; when associated with W-360; I-425 and M-426. Catalyzes the oxygenation of docosahexaenoic acid (DHA) to 10- and 17-HDHA; when associated with W-360; I-425 and M-426. Exhibits a lipoxin synthase activity towards (5S)-HETE as major substrates followed by (5S),(15S)-DiHETE and (15S)-HETE; when associated with W-360; I-425 and M-426.
Helix	585 – 591

Literature citations
Functional characterization of genetic enzyme variations in human lipoxygenases.
Horn T.; Reddy Kakularam K.; Anton M.; Richter C.; Reddanna P.; Kuhn H.;
Redox Biol. 1:566-577(2013)
Cited for: CATALYTIC ACTIVITY; FUNCTION; VARIANTS LYS-254; SER-337; SER-447; VAL-549; LEU-577; MET-591 AND GLN-656; CHARACTERIZATION OF VARIANTS LYS-254; SER-337; SER-447; VAL-549; LEU-577; MET-591 AND GLN-656;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.