Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q12756: Variant p.Arg11Trp

Kinesin-like protein KIF1A
Gene: KIF1A
Feedback?
Variant information Variant position: help 11 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Arginine (R) to Tryptophan (W) at position 11 (R11W, p.Arg11Trp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to large size and aromatic (W) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In SPG30A. Any additional useful information about the variant.


Sequence information Variant position: help 11 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1690 The length of the canonical sequence.
Location on the sequence: help MAGASVKVAV R VRPFNSREMSRDSKCIIQMS The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         MAGASVKVAVRVRPFNSREMSRDSKCIIQMS

Mouse                         MAGASVKVAVRVRPFNSREMSRDSKCIIQMS

Rat                           MAGASVKVAVRVRPFNSREMSRDSKCIIQMS

Drosophila                    --MSSVKVAVRVRPFNSREIARESKCIIEMA

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 1690 Kinesin-like protein KIF1A
Domain 5 – 354 Kinesin motor
Beta strand 6 – 12



Literature citations
Massive sequencing of 70 genes reveals a myriad of missing genes or mechanisms to be uncovered in hereditary spastic paraplegias.
Morais S.; Raymond L.; Mairey M.; Coutinho P.; Brandao E.; Ribeiro P.; Loureiro J.L.; Sequeiros J.; Brice A.; Alonso I.; Stevanin G.;
Eur. J. Hum. Genet. 25:1217-1228(2017)
Cited for: VARIANT SPG30A TRP-11;
Genotype and defects in microtubule-based motility correlate with clinical severity in KIF1A-associated neurological disorder.
Boyle L.; Rao L.; Kaur S.; Fan X.; Mebane C.; Hamm L.; Thornton A.; Ahrendsen J.T.; Anderson M.P.; Christodoulou J.; Gennerich A.; Shen Y.; Chung W.K.;
HGG Adv. 2:0-0(2021)
Cited for: INVOLVEMENT IN KAND; VARIANTS KAND CYS-13; HIS-13; ASP-54; ASP-89; THR-103; VAL-117; LYS-148; TYR-151; CYS-155; VAL-156; HIS-157; PRO-171; GLY-179; GLU-199; SER-203; VAL-206; THR-210; HIS-211; ASN-214; TYR-217; CYS-229; MET-247; GLY-248; ARG-251; PRO-254; GLN-267; SER-272; LEU-274; PRO-275; PRO-278; ARG-279; ASP-279; CYS-306; GLY-307; PRO-314; GLN-316 AND ASP-475; VARIANTS NESCAVS LEU-58; MET-99; PHE-186; ARG-199; ARG-215; CYS-216; HIS-216; LYS-253; GLN-254; TRP-254; GLN-307; PRO-307; TRP-316 AND MET-344; VARIANTS SPG30A GLN-11; TRP-11; SER-102; MET-258 AND LEU-305; CHARACTERIZATION OF VARIANTS KAND HIS-13; ASP-89; SER-117; TYR-217; GLY-248; ARG-251; PRO-254; LEU-274; PRO-278 AND MET-344; CHARACTERIZATION OF VARIANTS NESCAVS MET-99; LYS-253; GLN-254; TRP-254; PRO-307 AND TRP-316; CHARACTERIZATION OF VARIANT SPG30A SER-102; FUNCTION; SUBCELLULAR LOCATION;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.