Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9NQZ6: Variant p.Cys203Ser

Zinc finger C4H2 domain-containing protein
Gene: ZC4H2
Feedback?
Variant information Variant position: help 203 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Cysteine (C) to Serine (S) at position 203 (C203S, p.Cys203Ser). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (C) to small size and polar (S) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In WRWFFR. Any additional useful information about the variant.


Sequence information Variant position: help 203 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 224 The length of the canonical sequence.
Location on the sequence: help PPPMKACLSCHQQIHRNAPI C PLCKAKSRSRNPKKPKRKQD The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         PPPMKACLSCHQQIHRNAPICPLCKAKSRSRNPKKPKRKQD

Mouse                         PPPMKACLSCHQQIHRNAPICPLCKAKSRSRNPKKPKRKQD

Zebrafish                     PPPMKACLSCHQQIHRNAPICPLCKAKSRSRNPKKPKRKPD

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 224 Zinc finger C4H2 domain-containing protein
Zinc finger 186 – 212 C4H2-type
Binding site 189 – 189
Binding site 192 – 192
Binding site 203 – 203
Binding site 206 – 206
Alternative sequence 133 – 224 DYFEKQKAEWQTEPQEPPIPESLAAAAAAAQQLQVARKQDTRQTATFRQQPPPMKACLSCHQQIHRNAPICPLCKAKSRSRNPKKPKRKQDE -> EPACHVTSKFTGMHLYALFARPRVGPGTPKSRNGSRMNKEREST. In isoform 4.
Alternative sequence 134 – 224 Missing. In isoform 2.



Literature citations
Deleterious de novo variants of X-linked ZC4H2 in females cause a variable phenotype with neurogenic arthrogryposis multiplex congenita.
Frints S.G.M.; Hennig F.; Colombo R.; Jacquemont S.; Terhal P.; Zimmerman H.H.; Hunt D.; Mendelsohn B.A.; Kordass U.; Webster R.; Sinnema M.; Abdul-Rahman O.; Suckow V.; Fernandez-Jaen A.; van Roozendaal K.; Stevens S.J.C.; Macville M.V.E.; Al-Nasiry S.; van Gassen K.; Utzig N.; Koudijs S.M.; McGregor L.; Maas S.M.; Baralle D.; Dixit A.; Wieacker P.; Lee M.; Lee A.S.; Engle E.C.; Houge G.; Gradek G.A.; Douglas A.G.L.; Longman C.; Joss S.; Velasco D.; Hennekam R.C.; Hirata H.; Kalscheuer V.M.;
Hum. Mutat. 40:2270-2285(2019)
Cited for: INVOLVEMENT IN WRWFFR; VARIANTS WRWFFR 23-GLN--GLU-224 DEL; 67-ARG--GLU-224 DEL; GLN-70; 142-TRP--GLU-224 DEL; HIS-201; SER-203; TRP-213 AND PHE-206; VARIANTS WRWF GLN-198; THR-200; VAL-200; TRP-213 AND ARG-217;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.