UniProtKB/Swiss-Prot A5YKK6 : Variant p.Gln1494His
CCR4-NOT transcription complex subunit 1
Gene: CNOT1
Feedback ?
Variant information
Variant position:
1494
The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:
LP/P [Disclaimer : Variants classification is intended for research purposes only, not for clinical and diagnostic use . The label disease variant is assigned according to literature reports on probable disease-association that can be based on theoretical reasons. This label must not be considered as a definitive proof for the pathogenic role of a variant. ]
The variants are classified into three categories: LP/P, LB/B and US.LP/P: likely pathogenic or pathogenic. LB/B: likely benign or benign. US: uncertain significance
Residue change:
From Glutamine (Q) to Histidine (H) at position 1494 (Q1494H, p.Gln1494His).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:
Similar physico-chemical property. Both residues are medium size and polar.
The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:
0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another: Lowest score: -4 (low probability of substitution).Highest score: 11 (high probability of substitution). More information can be found on the following page
Variant description:
In VIBOS.
Any additional useful information about the variant.
Sequence information
Variant position:
1494
The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:
2376
The length of the canonical sequence.
Location on the sequence:
ASALRTASPQQREMMDQAAA
Q LAQDNCELACCFIQKTAVEK
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:
The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human ASALR--TASPQQREMMDQAAAQ LAQDNCELACCFIQKTAVEK
Mouse ASALR--TASPQQREMMDQAAAQ LAQDNCELACCFIQKTAV
Xenopus tropicalis ATAMR--AASPQQREMMEQAAAQ LAQDNCELACCFIQKTAV
Zebrafish AAALR--APTPQQREMMEEAAAR IAQDNCELACCFIQKTAV
Caenorhabditis elegans SSSLRSTAANPEMKQMIEDAAAT ITQDNVELSTNFIVKTAC
Sequence annotation in neighborhood:
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:Type: the type of sequence feature. Positions: endpoints of the sequence feature. Description: contains additional information about the feature.
Type Positions Description
Chain
1 – 2376
CCR4-NOT transcription complex subunit 1
Region
1090 – 1605
Interaction with CNOT6, CNOT6L, CNOT7 and CNOT8
Alternative sequence
1479 – 1551
TASPQQREMMDQAAAQLAQDNCELACCFIQKTAVEKAGPEMDKRLATEFELRKHARQEGRRYCDPVVLTYQAE -> VSWLFPWYRYKTYYCLSVIIFFFVYIWHWALPLILNNHHICLMSSIILDCNSVRQSIMSVCFFFFLLYSQHDV. In isoform 4.
Helix
1482 – 1522
Literature citations
De Novo Variants in CNOT1, a Central Component of the CCR4-NOT Complex Involved in Gene Expression and RNA and Protein Stability, Cause Neurodevelopmental Delay.
Vissers L.E.L.M.; Kalvakuri S.; de Boer E.; Geuer S.; Oud M.; van Outersterp I.; Kwint M.; Witmond M.; Kersten S.; Polla D.L.; Weijers D.; Begtrup A.; McWalter K.; Ruiz A.; Gabau E.; Morton J.E.V.; Griffith C.; Weiss K.; Gamble C.; Bartley J.; Vernon H.J.; Brunet K.; Ruivenkamp C.; Kant S.G.; Kruszka P.; Larson A.; Afenjar A.; Billette de Villemeur T.; Nugent K.; Raymond F.L.; Venselaar H.; Demurger F.; Soler-Alfonso C.; Li D.; Bhoj E.; Hayes I.; Hamilton N.P.; Ahmad A.; Fisher R.; van den Born M.; Willems M.; Sorlin A.; Delanne J.; Moutton S.; Christophe P.; Mau-Them F.T.; Vitobello A.; Goel H.; Massingham L.; Phornphutkul C.; Schwab J.; Keren B.; Charles P.; Vreeburg M.; De Simone L.; Hoganson G.; Iascone M.; Milani D.; Evenepoel L.; Revencu N.; Ward D.I.; Burns K.; Krantz I.; Raible S.E.; Murrell J.R.; Wood K.; Cho M.T.; van Bokhoven H.; Muenke M.; Kleefstra T.; Bodmer R.; de Brouwer A.P.M.;
Am. J. Hum. Genet. 107:164-172(2020)
Cited for: VARIANTS VIBOS 26-ARG--SER-2376 DEL; 33-GLN--SER-2376 DEL; 396-TYR--SER-2376 DEL; GLU-642; LYS-897; CYS-900; ILE-1038; LEU-1089; PRO-1148; GLY-1188; ARG-1241; ALA-1419; SER-1428; CYS-1478; HIS-1494; ASP-1572 AND SER-2216; INVOLVEMENT IN VIBOS;
Disclaimer:
Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.