Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P52630: Variant p.Arg148Gln

Signal transducer and activator of transcription 2
Gene: STAT2
Feedback?
Variant information Variant position: help 148 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Arginine (R) to Glutamine (Q) at position 148 (R148Q, p.Arg148Gln). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to medium size and polar (Q) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In PTORCH3; increased cellular sensitivity to type I IFNs; fails to appropriately traffic USP18 thereby preventing USP18 to inhibit responses to IFN-I. Any additional useful information about the variant.


Sequence information Variant position: help 148 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 851 The length of the canonical sequence.
Location on the sequence: help EQGEPVLETPVESQQHEIES R ILDLRAMMEKLVKSISQLKD The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         EQGEPVLETPVESQQHEIESRILDLRAMMEKLVKSISQLKD

Mouse                         VQPPPAPEAVVESQQLEIENRIQGLHVDIEFLVRSIRQLKD

Pig                           EQQEPALEAPGENQQHEIESRILELRAMMEKLVKSISQLKD
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 851 Signal transducer and activator of transcription 2
Region 138 – 572 Mediates interaction with USP18
Helix 141 – 182



Literature citations
Homozygous STAT2 gain-of-function mutation by loss of USP18 activity in a patient with type I interferonopathy.
Gruber C.; Martin-Fernandez M.; Ailal F.; Qiu X.; Taft J.; Altman J.; Rosain J.; Buta S.; Bousfiha A.; Casanova J.L.; Bustamante J.; Bogunovic D.;
J. Exp. Med. 217:0-0(2020)
Cited for: VARIANT PTORCH3 GLN-148; CHARACTERIZATION OF VARIANT PTORCH3 GLN-148; FUNCTION; INTERACTION WITH USP18;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.