Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot A0AVF1: Variant p.Asn263Ser

Intraflagellar transport protein 56
Gene: IFT56
Feedback?
Variant information Variant position: help 263 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Asparagine (N) to Serine (S) at position 263 (N263S, p.Asn263Ser). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (N) to small size and polar (S) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In BRENS; decreased protein abundance; associated with abnormal ciliary structure and function. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 263 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 554 The length of the canonical sequence.
Location on the sequence: help KSLMDNASSSFEFAKELIRH N LVVFRGGEGALQVLPPLVDV The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         KSLMDNASSSFEFAKE-------------LIRHNLVVFRGGEGALQVLPPLVDV

Mouse                         KSLMDNASSPFEFAKE-------------LIRHNLVVFRGG

Rat                           KSLMDNASSPFEFAKE-------------LIRHNLVVFRGG

Xenopus tropicalis            KGLMDSTSSPIEFAKE-------------LIKHNLVVFRAG

Zebrafish                     KNLIDISSSSFQFAKE-------------LIQHNLVVFRGG

Caenorhabditis elegans        ARNIDQEGLTMVSDMEALLKQKLYPEIEYICKHNLVLFKNC
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 554 Intraflagellar transport protein 56



Literature citations
Pituitary stalk interruption syndrome broadens the clinical spectrum of the TTC26 ciliopathy.
David O.; Eskin-Schwartz M.; Ling G.; Dolgin V.; Kristal E.; Benkowitz E.; Osyntsov L.; Gradstein L.; Birk O.S.; Loewenthal N.; Yerushalmi B.;
Clin. Genet. 98:303-307(2020)
Cited for: INVOLVEMENT IN BRENS; VARIANT BRENS SER-263;
Biallelic Mutations in Tetratricopeptide Repeat Domain 26 (Intraflagellar Transport 56) Cause Severe Biliary Ciliopathy in Humans.
Shaheen R.; Alsahli S.; Ewida N.; Alzahrani F.; Shamseldin H.E.; Patel N.; Al Qahtani A.; Alhebbi H.; Alhashem A.; Al-Sheddi T.; Alomar R.; Alobeid E.; Abouelhoda M.; Monies D.; Al-Hussaini A.; Alzouman M.A.; Shagrani M.; Faqeih E.; Alkuraya F.S.;
Hepatology 71:2067-2079(2020)
Cited for: VARIANTS BRENS SER-263 AND LEU-444; CHARACTERIZATION OF VARIANT BRENS SER-263; FUNCTION;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.