UniProtKB/Swiss-Prot P46821: Variant p.Ile923Thr

Microtubule-associated protein 1B
Gene: MAP1B
Feedback?

Variant information Variant position:

923 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Isoleucine (I) to Threonine (T) at position 923 (I923T, p.Ile923Thr). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and hydrophobic (I) to medium size and polar (T) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs143194383 [ dbSNP | Ensembl ]

Sequence information Variant position:

923 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

2468 The length of the canonical sequence.
Location on the sequence:

GECEQTPEELEPVEKQGVDD I EKFEDEGAGFEESSETGDYE The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         GECEQTPEELEPVEKQGVDDIEKFEDEGAGFEESSETGDYE

Mouse                         GECEQTPEELEPVEKQGVDDIEKFEDEGAGFEESSETGDYE

Rat                           GECEQTPEELEPVEKQGVDDIEKFEDEGAGFEESSEAGDYE

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	2 – 2468	Microtubule-associated protein 1B
Chain	2 – 2206	MAP1B heavy chain
Region	872 – 1045	Disordered
Compositional bias	914 – 923	Basic and acidic residues
Modified residue	908 – 908	Phosphothreonine
Modified residue	936 – 936	Phosphoserine
Modified residue	937 – 937	Phosphoserine

Literature citations
Mutations of MAP1B encoding a microtubule-associated phosphoprotein cause sensorineural hearing loss.
Cui L.; Zheng J.; Zhao Q.; Chen J.R.; Liu H.; Peng G.; Wu Y.; Chen C.; He Q.; Shi H.; Yin S.; Friedman R.A.; Chen Y.; Guan M.X.;
JCI Insight 5:0-0(2020)
Cited for: VARIANT DFNA83 GLY-1400; CHARACTERIZATION OF VARIANT DFNA83 GLY-1400; INVOLVEMENT IN DFNA83; FUNCTION; VARIANTS THR-923 AND LEU-1838;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.