Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q9HB75: Variant p.Arg815Trp

p53-induced death domain-containing protein 1
Gene: PIDD1
Feedback?
Variant information Variant position: help 815 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Arginine (R) to Tryptophan (W) at position 815 (R815W, p.Arg815Trp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to large size and aromatic (W) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In MRT75; loss of interaction with CRADD; loss of activation of CASP2 protein. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 815 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 910 The length of the canonical sequence.
Location on the sequence: help VAGRLGLDWPAVALHLGVSY R EVQRIRHEFRDDLDEQIRHM The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         VAGRLGLDWPAVALHLGVSYREVQRIRHEFRDDLDEQIRHM

Mouse                         VASRLGPDWPAVALHLGMPYHKLQRIRHEFRDDLDGQVRHM
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 2 – 910 p53-induced death domain-containing protein 1
Chain 446 – 910 PIDD-C
Chain 589 – 910 PIDD-CC
Domain 788 – 873 Death
Alternative sequence 622 – 910 Missing. In isoform 7.
Alternative sequence 759 – 815 RLRGSEGPRRGAGLSLAPLNLGDAETGFLTQSNLLSVAGRLGLDWPAVALHLGVSYR -> VGLRDSRGAGQDRGPGVTRVTWWSWGWSPGLNALFPSNRDFEGPRGHGGGLASPWHP. In isoform 5 and isoform 6.
Mutagenesis 801 – 801 L -> A. No effect on complex assembly with CRADD.
Mutagenesis 814 – 814 Y -> A. Loss of complex assembly with CRADD. Loss of PIDDosome assembly. Loss of CASP2 activation.
Mutagenesis 815 – 815 R -> A. Partial loss of complex assembly with CRADD.
Mutagenesis 815 – 815 R -> E. Loss of complex assembly with CRADD.
Mutagenesis 825 – 825 R -> A. Partial loss of complex assembly with CRADD.
Mutagenesis 825 – 825 R -> E. Partial loss of complex assembly with CRADD. Decreased PIDDosome assembly. Decreased CASP2 activation.
Mutagenesis 826 – 826 D -> K. Partial loss of complex assembly with CRADD.
Mutagenesis 828 – 828 L -> E. Loss of complex assembly with CRADD.
Mutagenesis 830 – 830 E -> K. No effect on complex assembly with CRADD.
Helix 814 – 823



Literature citations
Genetics of intellectual disability in consanguineous families.
Hu H.; Kahrizi K.; Musante L.; Fattahi Z.; Herwig R.; Hosseini M.; Oppitz C.; Abedini S.S.; Suckow V.; Larti F.; Beheshtian M.; Lipkowitz B.; Akhtarkhavari T.; Mehvari S.; Otto S.; Mohseni M.; Arzhangi S.; Jamali P.; Mojahedi F.; Taghdiri M.; Papari E.; Soltani Banavandi M.J.; Akbari S.; Tonekaboni S.H.; Dehghani H.; Ebrahimpour M.R.; Bader I.; Davarnia B.; Cohen M.; Khodaei H.; Albrecht B.; Azimi S.; Zirn B.; Bastami M.; Wieczorek D.; Bahrami G.; Keleman K.; Vahid L.N.; Tzschach A.; Gaertner J.; Gillessen-Kaesbach G.; Varaghchi J.R.; Timmermann B.; Pourfatemi F.; Jankhah A.; Chen W.; Nikuei P.; Kalscheuer V.M.; Oladnabi M.; Wienker T.F.; Ropers H.H.; Najmabadi H.;
Mol. Psychiatry 24:1027-1039(2019)
Cited for: VARIANT MRT75 TRP-815;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.