Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P78381: Variant p.Pro118Arg

UDP-galactose translocator
Gene: SLC35A2
Feedback?
Variant information Variant position: help 118 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Proline (P) to Arginine (R) at position 118 (P118R, p.Pro118Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (P) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In CDG2M. Any additional useful information about the variant.


Sequence information Variant position: help 118 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 396 The length of the canonical sequence.
Location on the sequence: help VLFLHEAVLVQYVDTLKLAV P SLIYTLQNNLQYVAISNLPA The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         VLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPA

                              ALFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNMPA

Mouse                         VLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPA

Bovine                        VLFLHEAVLVQYMDTLKLAVPSLIYTLQNNLQYIAISNLPA

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 396 UDP-galactose translocator
Mutagenesis 125 – 125 Q -> A. Does not rescue defective Gb3Cer expression in SLC35A2-deficient cells suggesting loss of UDP-galactose transport; when associated with A-126, A-129 and A-278. No effect on localization to Golgi apparatus.
Mutagenesis 126 – 126 N -> A. Does not rescue defective Gb3Cer expression in SLC35A2-deficient cells suggesting loss of UDP-galactose transport; when associated with A-125, A-129 and A-278. No effect on localization to Golgi apparatus.
Mutagenesis 129 – 129 Q -> A. Does not rescue defective Gb3Cer expression in SLC35A2-deficient cells suggesting loss of UDP-galactose transport; when associated with A-125, A-126 and A-278. No effect on localization to Golgi apparatus.



Literature citations
SLC35A2-CDG: Functional characterization, expanded molecular, clinical, and biochemical phenotypes of 30 unreported individuals.
Ng B.G.; Sosicka P.; Agadi S.; Almannai M.; Bacino C.A.; Barone R.; Botto L.D.; Burton J.E.; Carlston C.; Chung B.H.; Cohen J.S.; Coman D.; Dipple K.M.; Dorrani N.; Dobyns W.B.; Elias A.F.; Epstein L.; Gahl W.A.; Garozzo D.; Hammer T.B.; Haven J.; Heron D.; Herzog M.; Hoganson G.E.; Hunter J.M.; Jain M.; Juusola J.; Lakhani S.; Lee H.; Lee J.; Lewis K.; Longo N.; Lourenco C.M.; Mak C.C.Y.; McKnight D.; Mendelsohn B.A.; Mignot C.; Mirzaa G.; Mitchell W.; Muhle H.; Nelson S.F.; Olczak M.; Palmer C.G.S.; Partikian A.; Patterson M.C.; Pierson T.M.; Quinonez S.C.; Regan B.M.; Ross M.E.; Guillen Sacoto M.J.; Scaglia F.; Scheffer I.E.; Segal D.; Singhal N.S.; Striano P.; Sturiale L.; Symonds J.D.; Tang S.; Vilain E.; Willis M.; Wolfe L.A.; Yang H.; Yano S.; Powis Z.; Suchy S.F.; Rosenfeld J.A.; Edmondson A.C.; Grunewald S.; Freeze H.H.;
Hum. Mutat. 40:908-925(2019)
Cited for: VARIANTS CDG2M PRO-55; 56-TYR--SER-396 DEL; 65-PHE--THR-68 DEL; MET-71; PHE-82; PRO-101; PRO-116; ARG-118; CYS-130; 168-GLN--SER-396 DEL; LEU-175 DEL; PHE-175; 183-GLN--SER-396 DEL; SER-188; PRO-233; 272-TRP--SER-396 DEL; ASP-273; PRO-303; TYR-312; PRO-315 AND ILE-331; CHARACTERIZATION OF VARIANTS CDG2M MET-71; PHE-82; CYS-130; 168-GLN--SER-396 DEL; PRO-233 AND PRO-315; FUNCTION;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.