Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q12805: Variant p.Cys55Arg

EGF-containing fibulin-like extracellular matrix protein 1
Gene: EFEMP1
Feedback?
Variant information Variant position: help 55 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Cysteine (C) to Arginine (R) at position 55 (C55R, p.Cys55Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (C) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In ARCL1D; likely pathogenic; forms aberrant extracellular disulfide-linked homodimers; loss of function variant unable to rescue extracellular matrix defects when expressed in EFEMP1-deficient cells. Any additional useful information about the variant.


Sequence information Variant position: help 55 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 493 The length of the canonical sequence.
Location on the sequence: help WDPVRQQCKDIDECDIVPDA C KGGMKCVNHYGGYLCLPKTA The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         WDPVRQQCKDIDECDIVPDACKGGMKCVNHYGGYLCLPKTA

Mouse                         WDPIRQQCKDIDECDIVPDACKGGMKCVNHYGGYLCLPKTA

Rat                           WDPVRQQCKDIDECDIVPDACKGGMKCVNHYGGYLCLPKTA

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 18 – 493 EGF-containing fibulin-like extracellular matrix protein 1
Domain 26 – 71 EGF-like 1; atypical
Alternative sequence 1 – 58 Missing. In isoform 5.
Alternative sequence 58 – 58 Missing. In isoform 3.
Mutagenesis 42 – 42 C -> A. Produces extracellular disulfide-linked homodimers similar as Cys55Arg mutation.
Mutagenesis 48 – 48 C -> A. Produces extracellular disulfide-linked homodimers similar as Cys55Arg mutation.
Mutagenesis 61 – 61 C -> A. Produces extracellular disulfide-linked homodimers similar as Cys55Arg mutation.
Mutagenesis 70 – 70 C -> A. Produces extracellular disulfide-linked homodimers similar as Cys55Arg mutation.



Literature citations
Recessive marfanoid syndrome with herniation associated with a homozygous mutation in Fibulin-3.
Bizzari S.; El-Bazzal L.; Nair P.; Younan A.; Stora S.; Mehawej C.; El-Hayek S.; Delague V.; Megarbane A.;
Eur. J. Med. Genet. 63:103869-103869(2020)
Cited for: VARIANT ARCL1D ARG-55;
A loss-of-function cysteine mutant in fibulin-3 (EFEMP1) forms aberrant extracellular disulfide-linked homodimers and alters extracellular matrix composition.
Woodard D.R.; Daniel S.; Nakahara E.; Abbas A.; DiCesare S.M.; Collier G.E.; Hulleman J.D.;
Hum. Mutat. 43:1945-1955(2022)
Cited for: CHARACTERIZATION OF VARIANT ARCL1D ARG-55; MUTAGENESIS OF CYS-29; CYS-42; CYS-48; CYS-55; CYS-61; CYS-70; CYS-159 AND CYS-171; SUBCELLULAR LOCATION;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.