Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q7Z3V4: Variant p.Gly779Arg

Ubiquitin-protein ligase E3B
Gene: UBE3B
Feedback?
Variant information Variant position: help 779 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Glycine (G) to Arginine (R) at position 779 (G779R, p.Gly779Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In KOS; likely pathogenic; loss of positive regulation of neuron projection arborization; contrary to the wild type, it fails to rescue defective neurite branching in UBE3B-KO mouse primary hippocampal neurons. Any additional useful information about the variant.


Sequence information Variant position: help 779 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1068 The length of the canonical sequence.
Location on the sequence: help LYPSPTSYIHENYLQLFEFV G KMLGKAVYEGIVVDVPFASF The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         LYPSPTSYIHENYLQLFEFVGKMLGKAVYEGIVVDVPFASF

Mouse                         LYPSPTSYIHENYLQLFEFVGKMLGKAVYEGIVVDVPFASF

Xenopus tropicalis            LYPSPTSYIHENYLQLFEFVGKMLGKAVYEGIVVDVPFASF

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 1068 Ubiquitin-protein ligase E3B
Domain 702 – 1068 HECT
Alternative sequence 245 – 1068 Missing. In isoform 3.
Alternative sequence 709 – 1068 Missing. In isoform 2.



Literature citations
Expanding the clinical and mutational spectrum of Kaufman oculocerebrofacial syndrome with biallelic UBE3B mutations.
Basel-Vanagaite L.; Yilmaz R.; Tang S.; Reuter M.S.; Rahner N.; Grange D.K.; Mortenson M.; Koty P.; Feenstra H.; Farwell Gonzalez K.D.; Sticht H.; Boddaert N.; Desir J.; Anyane-Yeboa K.; Zweier C.; Reis A.; Kubisch C.; Jewett T.; Zeng W.; Borck G.;
Hum. Genet. 133:939-949(2014)
Cited for: VARIANTS KOS 21-GLU--SER-1068 DEL; HIS-482; PRO-539; 700-GLN--SER-1068 DEL; ARG-779 AND PRO-997; INVOLVEMENT IN KOS;
The murine ortholog of Kaufman oculocerebrofacial syndrome protein Ube3b regulates synapse number by ubiquitinating Ppp3cc.
Ambrozkiewicz M.C.; Borisova E.; Schwark M.; Ripamonti S.; Schaub T.; Smorodchenko A.; Weber A.I.; Rhee H.J.; Altas B.; Yilmaz R.; Mueller S.; Piepkorn L.; Horan S.T.; Straussberg R.; Zaqout S.; Jahn O.; Dere E.; Rosario M.; Boehm-Sturm P.; Borck G.; Willig K.I.; Rhee J.; Tarabykin V.; Kawabe H.;
Mol. Psychiatry 26:1980-1995(2021)
Cited for: CHARACTERIZATION OF VARIANTS KOS ARG-779 AND PRO-997;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.