Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q08211: Variant p.Gly411Glu

ATP-dependent RNA helicase A
Gene: DHX9
Feedback?
Variant information Variant position: help 411 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Glycine (G) to Glutamate (E) at position 411 (G411E, p.Gly411Glu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to medium size and acidic (E) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In MRD75; likely pathogenic; decreased ATP hydrolysis activity. Any additional useful information about the variant.


Sequence information Variant position: help 411 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1270 The length of the canonical sequence.
Location on the sequence: help KKFESEILEAISQNSVVIIR G ATGCGKTTQVPQFILDDFIQ The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         KKFESEILEAISQNSVVIIRGATGCGKTTQVPQFILDDFIQ

Mouse                         KKFEAEILEAISSNSVVIIRGATGCGKTTQVPQYILDDFIQ

Bovine                        KKFESEILEAISQNPVVIIRGATGCGKTTQVPQFILDDCIQ

Xenopus laevis                KKFEEEIMHAVHNSPVVIIRGATGCGKTTQVPQYILDEYIR

Caenorhabditis elegans        AQYRENIVQTVAENRVTLIKGETGCGKSTQVAQFLLESFLE
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 1270 ATP-dependent RNA helicase A
Domain 398 – 564 Helicase ATP-binding
Region 255 – 664 Necessary for interaction with RNA polymerase II holoenzyme
Region 313 – 952 Necessary for interaction with H2AX
Region 398 – 809 Core helicase
Binding site 411 – 419
Binding site 418 – 418
Alternative sequence 1 – 1035 Missing. In isoform 2.
Mutagenesis 417 – 417 K -> RN. Inhibits interaction with AGO2, DICER1 and TARBP2. Abrogates helicase activity and transcriptional activation. Does not inhibit binding to origins of DNA replication.
Mutagenesis 417 – 417 K -> R. Reduces NUP98-induced mRNA transcription and alternative splicing activities.
Beta strand 405 – 411



Literature citations
Monoallelic variation in DHX9, the gene encoding the DExH-box helicase DHX9, underlies neurodevelopment disorders and Charcot-Marie-Tooth disease.
Calame D.G.; Guo T.; Wang C.; Garrett L.; Jolly A.; Dawood M.; Kurolap A.; Henig N.Z.; Fatih J.M.; Herman I.; Du H.; Mitani T.; Becker L.; Rathkolb B.; Gerlini R.; Seisenberger C.; Marschall S.; Hunter J.V.; Gerard A.; Heidlebaugh A.; Challman T.; Spillmann R.C.; Jhangiani S.N.; Coban-Akdemir Z.; Lalani S.; Liu L.; Revah-Politi A.; Iglesias A.; Guzman E.; Baugh E.; Boddaert N.; Rondeau S.; Ormieres C.; Barcia G.; Tan Q.K.G.; Thiffault I.; Pastinen T.; Sheikh K.; Biliciler S.; Mei D.; Melani F.; Shashi V.; Yaron Y.; Steele M.; Wakeling E.; Oestergaard E.; Nazaryan-Petersen L.; Millan F.; Santiago-Sim T.; Thevenon J.; Bruel A.L.; Thauvin-Robinet C.; Popp D.; Platzer K.; Gawlinski P.; Wiszniewski W.; Marafi D.; Pehlivan D.; Posey J.E.; Gibbs R.A.; Gailus-Durner V.; Guerrini R.; Fuchs H.; Hrabe de Angelis M.; Hoelter S.M.; Cheung H.H.; Gu S.; Lupski J.R.;
Am. J. Hum. Genet. 110:1394-1413(2023)
Cited for: VARIANTS MRD75 GLN-141; 229-ARG--TYR-1270 DEL; GLU-411; ILE-473; GLY-608; TRP-761; GLN-761; 764-ARG--TYR-1270 DEL; GLN-1052; ARG-1163; PRO-1166 AND 1263-GLN--TYR-1270 DEL; VARIANTS THR-837; GLY-846 AND THR-1255; INVOLVEMENT IN MRD75; CHARACTERIZATION OF VARIANTS MRD75 GLU-411; ILE-473; GLY-608; GLN-761; ARG-1163 AND PRO-1166; FUNCTION; SUBCELLULAR LOCATION;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.