Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q95460: Variant p.Arg31His

Major histocompatibility complex class I-related protein 1
Gene: MR1
Feedback?
Variant information Variant position: help 31 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Arginine (R) to Histidine (H) at position 31 (R31H, p.Arg31His). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to medium size and polar (H) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Polymorphism: help Initially considered monomorphic, however recent studies show MR1 genetic diversity in human populations with allelic variants that impact antigen presentation. An analysis of a small cohort of 56 donors found six distinct alleles with MR1*01 and MR1*02 being the most frequent ones. The sequence shown is that of MR1*01. Additional information on the polymorphism described.
Variant description: help In allele MR1*04; found in an individual with unexplained primary immunodeficiency; selective loss of circulating MAIT cells and other MR1-restricted T cell clones; decreased memory B cell frequencies; sevenfold increased circulating gamma-delta T cell frequency due to expansion of Vgamma9/Vdelta2-positive T cells; decreased B cell antigen presentation to allogeneic MAIT cells; loss of 5-OP-RU binding; increased internalization rate of both ligand-free and ligand-bound forms; no effect on antibacterial response ex vivo; no effect on vaccine response. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 31 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 341 The length of the canonical sequence.
Location on the sequence: help LIIVLMVKHSDSRTHSLRYF R LGVSDPIHGVPEFISVGYVD The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         LII----------------------------------VLMVKH--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SDSRTHSLR-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------YFR-------------LGVSDPI------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------HGV-------------------------------------------------PEF-----------------------------------------ISVGYVD

Chimpanzee                    LII----------------------------------VLMV

Mouse                         LLA----------------------------------VFLV

Rat                           FLT----------------------------------VFLA

Bovine                        LII----------------------------------VLMM

Caenorhabditis elegans        ITVRNRKNFVISPISKIDKISKYSSPFSVMTRGKSVDIVMM

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 23 – 341 Major histocompatibility complex class I-related protein 1
Topological domain 23 – 302 Extracellular
Region 23 – 201 Antigen-binding cleft
Region 23 – 109 Alpha-1
Binding site 31 – 31
Binding site 31 – 31
Binding site 31 – 31
Binding site 31 – 31
Binding site 46 – 46
Binding site 46 – 46
Binding site 46 – 46
Beta strand 25 – 36



Literature citations
Absence of mucosal-associated invariant T cells in a person with a homozygous point mutation in MR1.
Howson L.J.; Awad W.; von Borstel A.; Lim H.J.; McWilliam H.E.G.; Sandoval-Romero M.L.; Majumdar S.; Hamzeh A.R.; Andrews T.D.; McDermott D.H.; Murphy P.M.; Le Nours J.; Mak J.Y.W.; Liu L.; Fairlie D.P.; McCluskey J.; Villadangos J.A.; Cook M.C.; Turner S.J.; Davey M.S.; Ojaimi S.; Rossjohn J.;
Sci. Immunol. 5:0-0(2020)
Cited for: X-RAY CRYSTALLOGRAPHY (1.89 ANGSTROMS) OF 23-292; CHARACTERIZATION OF VARIANT HIS-31; FUNCTION;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.