Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot O00469: Variant p.His666Arg

Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
Gene: PLOD2
Feedback?
Variant information Variant position: help 666 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Histidine (H) to Arginine (R) at position 666 (H666R, p.His666Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (H) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In BRKS2; likely pathogenic. Any additional useful information about the variant.


Sequence information Variant position: help 666 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 737 The length of the canonical sequence.
Location on the sequence: help FALLNFVVKYSPERQRSLRP H HDASTFTINIALNNVGEDFQ The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         FALLNFVVKYSPERQRSLRPHHDASTFTINIALNNVGEDFQ

Mouse                         FALLNFVVKYSPERQRSLRPHHDASTFTINIALNNVGEDFQ

Rat                           FALLNFVVKYSPERQRSLRPHHDASTFTINIALNNVGEDFQ

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 26 – 737 Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
Domain 644 – 737 Fe2OG dioxygenase
Binding site 666 – 666
Binding site 668 – 668



Literature citations
Expanding the Clinical Spectrum of Phenotypes Caused by Pathogenic Variants in PLOD2.
Leal G.F.; Nishimura G.; Voss U.; Bertola D.R.; Aastroem E.; Svensson J.; Yamamoto G.L.; Hammarsjoe A.; Horemuzova E.; Papadiogannakis N.; Iwarsson E.; Grigelioniene G.; Tham E.;
J. Bone Miner. Res. 33:753-760(2018)
Cited for: VARIANTS BRKS2 166-SER--PRO-737 DEL; 540-TRP--PRO-737 DEL; VAL-564; CYS-567 AND ARG-666;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.